[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS80657.1
DDBJ      :             hypothetical membrane spanning protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:246 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   3->237 PF01925 * TauE 2.4e-37 40.4 230/239  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS80657.1 GT:GENE AAS80657.1 GT:PRODUCT hypothetical membrane spanning protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(296984..297724) GB:FROM 296984 GB:TO 297724 GB:DIRECTION - GB:PRODUCT hypothetical membrane spanning protein GB:PROTEIN_ID AAS80657.1 GB:DB_XREF GI:46196240 LENGTH 246 SQ:AASEQ MAFLLGFLIAFAIGVTGVGAGTVTAPLLILALGLPPEVAVGTALLFGFLVKVPAGAVYLLRRQVDARALLRLLLGGVPGVLLGSLLLTQLKGAKDLVLLLVGLTVVLSAGLGLWRGLKGVGRGRERPWLLPPAAFGIGLEVGFSSAGAGALGTLLLLHATRLSPQKVVGTDLLFGLVLALLGGGVHLAFGQVAPSLLLALASGGVAGGLLGALFATRLPKEPLRLALLLWLLFIGGQLVYRGVVHG GT:EXON 1|1-246:0| TM:NTM 8 TM:REGION 6->28| TM:REGION 39->60| TM:REGION 66->88| TM:REGION 92->114| TM:REGION 132->154| TM:REGION 168->190| TM:REGION 196->218| TM:REGION 223->245| SEG 12->36|aigvtgvgagtvtapllilalglpp| SEG 59->113|llrrqvdarallrlllggvpgvllgsllltqlkgakdlvlllvgltvvlsaglgl| SEG 146->157|agagalgtllll| SEG 172->190|llfglvlallgggvhlafg| SEG 192->213|vapslllalasggvaggllgal| SEG 223->232|lrlalllwll| HM:PFM:NREP 1 HM:PFM:REP 3->237|PF01925|2.4e-37|40.4|230/239|TauE| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 246-247| PSIPRED cHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHcHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHccccccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHcc //