[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS80662.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:173 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   83->138 PF06197 * DUF998 0.00097 26.8 56/144  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS80662.1 GT:GENE AAS80662.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(301621..302142) GB:FROM 301621 GB:TO 302142 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAS80662.1 GB:DB_XREF GI:46196245 LENGTH 173 SQ:AASEQ MRPYLALTSLLFGLHLGAAAVAALGLPAPVLGLAAFAAGACLGLGLSLLARRLPLPHLLLFALLLNPSAWVAVALLRPEPDPMNLGLFVAMVAFTLLLLGTLLLLLAALLPPWLAPWPLALAGLFLVPLFALLGDTLGQALPLWARWGALFLGAALTAFGLAGGVRGQGAPYP GT:EXON 1|1-173:0| TM:NTM 6 TM:REGION 4->26| TM:REGION 28->50| TM:REGION 56->77| TM:REGION 86->108| TM:REGION 116->138| TM:REGION 147->167| SEG 9->65|sllfglhlgaaavaalglpapvlglaafaagaclglglsllarrlplphlllfalll| SEG 93->126|aftllllgtlllllaallppwlapwplalaglfl| SEG 148->164|galflgaaltafglagg| HM:PFM:NREP 1 HM:PFM:REP 83->138|PF06197|0.00097|26.8|56/144|DUF998| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 169-173| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHccHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccc //