[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS80670.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  5/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:208 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   75->124 PF02970 * TBCA 0.00011 34.0 50/90  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS80670.1 GT:GENE AAS80670.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(308369..308995) GB:FROM 308369 GB:TO 308995 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAS80670.1 GB:DB_XREF GI:46196253 LENGTH 208 SQ:AASEQ MRRGLAVLLPFLPLALAWQPALDLELARQVVDGAYSRIPPLPTAVELSPLEVRVLRGEGCLPFPGSRPVWARVAGQAEVVEILAERARNEFRRVQAEEVLPEAKRLLPDGHLRVYLRLSGLKRLEHRAAYTLGVRLKTPEGESYVRAYRATYLDDWQEKEDGYTGTLVFYLDFSGKPVDPKGPLEVVFLTESEKDCLYAFTVDLGAFY GT:EXON 1|1-208:0| SEG 5->24|lavllpflplalawqpaldl| HM:PFM:NREP 1 HM:PFM:REP 75->124|PF02970|0.00011|34.0|50/90|TBCA| OP:NHOMO 5 OP:NHOMOORG 5 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3| PSIPRED ccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccccccEEEEEccEEEEEEEcccccccccccEEEEEEEccEEEEEEEEEcHHHHHHcccHHHHccHHHHHccccEEEEEEEEEccccHHHHHHEEEEEEEEccccHHHHHHHHHHHHHHHHccccccEEEEEEEEEcccccccccccEEEEEEEcccccEEEEEEEEHHHcc //