[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS80675.1
DDBJ      :             glucose transport system permease protein
Swiss-Prot:             

Homologs  Archaea  21/68 : Bacteria  393/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
f.58.1
:369 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   229->302 2r6gG PDBj 1e-06 41.5 %
:RPS:PDB   260->297 3dhwA PDBj 5e-10 34.2 %
:RPS:SCOP  208->337 2r6gG1  f.58.1.1 * 9e-13 20.2 %
:RPS:PFM   207->314 PF00528 * BPD_transp_1 3e-08 38.5 %
:HMM:PFM   90->365 PF00528 * BPD_transp_1 1.5e-14 22.6 177/185  
:BLT:SWISS 3->138 UGPA_AGRT5 7e-08 25.4 %
:BLT:SWISS 232->368 Y1215_PYRHO 3e-22 51.1 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS80675.1 GT:GENE AAS80675.1 GT:PRODUCT glucose transport system permease protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(311790..312899) GB:FROM 311790 GB:TO 312899 GB:DIRECTION - GB:PRODUCT glucose transport system permease protein GB:PROTEIN_ID AAS80675.1 GB:DB_XREF GI:46196258 LENGTH 369 SQ:AASEQ MRDRILAFLVLLPSVLAVGVFVYGFIGQNLWVSLTDWGKDPAQALALRPELRFVGLENYRELFTGFVDVRFRQSVVNLIFFTLFFMAGSLGLGLLLALAVDKAPRGEGFFRTVFLFPMALSFVVTGTIWRWLLQPQGGVNVLPTLFGLPPLSFPWLATREQVLVFDWNRLPFYTALVVGLVLLYVAYTAYREGERRRALWGLASAGVLLLWAFAFGQGLRLLPYPEVHGFSLALVGVILAAVWQMSGYTMALYLAGLRGIPVEVLEAARVDGASEWQLFRRVIFPMLAPITLSAMIVLGHIALKIFDLVFAMAGLDYAPTDVPAIYMYLLAFRGNQFAKGAAIGILLLLLVAVVVVPYLATQLRKEVRR GT:EXON 1|1-369:0| BL:SWS:NREP 2 BL:SWS:REP 3->138|UGPA_AGRT5|7e-08|25.4|126/293| BL:SWS:REP 232->368|Y1215_PYRHO|3e-22|51.1|137/292| TM:NTM 8 TM:REGION 4->26| TM:REGION 78->100| TM:REGION 110->132| TM:REGION 171->193| TM:REGION 199->221| TM:REGION 225->247| TM:REGION 286->308| TM:REGION 332->354| SEG 87->99|agslglglllala| SEG 173->190|ytalvvglvllyvaytay| SEG 340->356|gaaigilllllvavvvv| BL:PDB:NREP 1 BL:PDB:REP 229->302|2r6gG|1e-06|41.5|65/284| RP:PDB:NREP 1 RP:PDB:REP 260->297|3dhwA|5e-10|34.2|38/203| RP:PFM:NREP 1 RP:PFM:REP 207->314|PF00528|3e-08|38.5|104/195|BPD_transp_1| HM:PFM:NREP 1 HM:PFM:REP 90->365|PF00528|1.5e-14|22.6|177/185|BPD_transp_1| GO:PFM:NREP 3 GO:PFM GO:0005215|"GO:transporter activity"|PF00528|IPR000515| GO:PFM GO:0006810|"GO:transport"|PF00528|IPR000515| GO:PFM GO:0016020|"GO:membrane"|PF00528|IPR000515| RP:SCP:NREP 1 RP:SCP:REP 208->337|2r6gG1|9e-13|20.2|129/284|f.58.1.1| OP:NHOMO 1380 OP:NHOMOORG 415 OP:PATTERN 11--31---1--1---31111---3--2--2-----------------------1241--11-1---- ---1I2-2333-1112233-3-2247333334-33313443--2BZE-488-C9C113--44647258B8133337441---3-----------------------------------------------------33366---52221211-1111111222221-223--1-----1----A9-5634-532------11-------A83311--112613132122118O--------------------121-11---------11-----2--1-1-----21123323332223-------------121---222142-18-----112-342--12226------4--12---1A---65561-1-------11111--654---3122145544555558---2--1--3B--MFF8KHHUQLIH-----5842222953--------2--1--12-----------------------------1---1--11114554443-111225522211133311----1114----122432-------2---------------------1--11111-------------22---------------------------------------2---------------------------------244-2-1--1111111--1111-1111-1-11111-23222-------------------2---1111--133333333333---------11111-326---------------------------11111111111111111-------------------1-122--111111111111-------------------1--------------------------3C7657E586-1- --------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 116 STR:RPRED 31.4 SQ:SECSTR ############################################################################################################################################################################################################HHHHHHHHHc#TTcTTTGGGTTTcHHHHHHTTTTHHHHHHHHHHHHHHHHHHHTTccTTTTTHHHHHTccTHHHHHHTTHHHHHHHHHHHHHHHHHHHTTcHHHHHHHHH#GGGGccG############################################### DISOP:02AL 366-369| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEcccccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //