[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS80676.1
DDBJ      :             glucose-binding protein
Swiss-Prot:             

Homologs  Archaea  22/68 : Bacteria  161/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.94.1
:414 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   22->412 2b3bA PDBj 0.0 99.0 %
:RPS:PDB   22->412 2b3bA PDBj 2e-50 95.7 %
:RPS:SCOP  15->346 1j1nA  c.94.1.1 * 3e-33 13.7 %
:HMM:SCOP  16->406 1eljA_ c.94.1.1 * 6e-59 25.6 %
:RPS:PFM   31->324 PF01547 * SBP_bac_1 2e-14 29.0 %
:HMM:PFM   32->325 PF01547 * SBP_bac_1 1.9e-32 24.5 273/314  
:BLT:SWISS 22->384 Y1214_PYRHO 5e-63 35.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS80676.1 GT:GENE AAS80676.1 GT:PRODUCT glucose-binding protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(312943..314187) GB:FROM 312943 GB:TO 314187 GB:DIRECTION - GB:PRODUCT glucose-binding protein GB:PROTEIN_ID AAS80676.1 GB:DB_XREF GI:46196259 LENGTH 414 SQ:AASEQ MRKWLLAIGMVLGLSALAQGGKLEIFSWWAGDEGPALEALIRLYKQKYPGVEVINATVTGGAGVNARAVLKTRMLGGDPPDTFQVHAGMELIGTWVVANRMEDLSALFRQEGWLQAFPKGLIDLISYKGGIWSVPVNIHRSNVMWYLPAKLKEWGVNPPRTWDEFLATCQTLKQKGLEAPLALGENWTQQHLWESVALAVLGPDDWNNLWNGKLKFTDPKAVRAWEVFGRVLDCANKDAAGLSWQQAVDRVVQGKAAFNVMGDWAAGYMTTTLKLKPGTDFAWAPSPGTQGVFMMLSDSFGLPKGAKNRQNAINWLRLVGSKEGQDTFNPLKGSIAARLDSDPSKYNAYGQSAMRDWRSNRIVGSLVHGAVAPESFMSQFGTVMEIFLQTRNPQAAANAAQAIADQVGLGRLGQ GT:EXON 1|1-414:0| BL:SWS:NREP 1 BL:SWS:REP 22->384|Y1214_PYRHO|5e-63|35.0|357/441| SEG 394->406|qaaanaaqaiadq| BL:PDB:NREP 1 BL:PDB:REP 22->412|2b3bA|0.0|99.0|391/392| RP:PDB:NREP 1 RP:PDB:REP 22->412|2b3bA|2e-50|95.7|391/392| RP:PFM:NREP 1 RP:PFM:REP 31->324|PF01547|2e-14|29.0|272/282|SBP_bac_1| HM:PFM:NREP 1 HM:PFM:REP 32->325|PF01547|1.9e-32|24.5|273/314|SBP_bac_1| GO:PFM:NREP 2 GO:PFM GO:0005215|"GO:transporter activity"|PF01547|IPR006059| GO:PFM GO:0006810|"GO:transport"|PF01547|IPR006059| RP:SCP:NREP 1 RP:SCP:REP 15->346|1j1nA|3e-33|13.7|329/492|c.94.1.1| HM:SCP:REP 16->406|1eljA_|6e-59|25.6|363/380|c.94.1.1|1/1|Periplasmic binding protein-like II| OP:NHOMO 316 OP:NHOMOORG 183 OP:PATTERN 11--2---1322112-21212---1--2-11-------------------------2---12------ ----3--------------------1--------------1----42----1--1-----11211--3-1------2-----1------------------------------------------------------1111---11--------------------1----------------12-11-1-1-----------------11--2----113111--------8---------------------1--------------------------------11------------------------1---------2---2-------1-131------1--1---2--------4---1113----------------------------1111111-112----------3--811467555532-----12211-1211---------------1-----------------------------1----------344232211112254222111123---------2-2---2-2-1-----------------------------1--1------------------------------------------------111-----1-3-----------------1----------------------------------------------------------------------------------------------------------------413-------------------------1-11111111111111111-------------2------1211------------------------------------------------------------12111-2-2---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 408 STR:RPRED 98.6 SQ:SECSTR ####ccEEEEEEEEEccccTTEEEEEEcccGGGcHHHHHHHHHHHHHcTTcEEEEEEcccGGGHHHHHHHHHHHHTTccccEEEEETTHHHHHHTTTTTcccccHHHHHHHTHHHHccHHHHHHTEETTEEccEEcccEEccEEEEcHHHHHHTTccccccHHHHHHHHHHHHHTTccccEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHTcccTTcHHHHHHHHHHHHHHTTccTTGGGccHHHHHHHHHHTcccEEEccTHHHHHHHHTTccccTTTcEEEEcTTcTTEEEEEcEEEcccTTcTTHHHHHHHHHHHTcHHHHHHHHHHHccccccTTccGGGccHHHHHHHHHHHHcEEEEcTTTTccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHTTTcc## DISOP:02AL 412-414| PSIPRED cHHHHHHHHHHHHHHccccccEEEEEEEEccccHHHHHHHHHHHHHHccccEEEEEEEccccHHHHHHHHHHHHHcccccEEEEEcccHHHHHHHHHccccccccHHcccccHHHHHHHHHHHHHccccEEEEEEEEEccEEEEEEEHHHHHHccccccccHHHHHHHHHHHHHccccEEEEccccccHHHHHHHHHHHHccHHHHHHccccccccccHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHcccEEEEEcccccHHHHHHHHHHcccccEEEEEcccccccEEEEccEEEEEcccccHHHHHHHHHHHHcHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccccc //