[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS80684.1
DDBJ      :             branched amino acid transport system permease
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:299 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   33->282 PF02653 * BPD_transp_2 8.1e-30 28.2 248/267  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS80684.1 GT:GENE AAS80684.1 GT:PRODUCT branched amino acid transport system permease GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(320316..321215) GB:FROM 320316 GB:TO 321215 GB:DIRECTION - GB:PRODUCT branched amino acid transport system permease GB:PROTEIN_ID AAS80684.1 GB:DB_XREF GI:46196267 LENGTH 299 SQ:AASEQ MRGVFAFLLLFALLPFLPLGVWRAFLLDVGLFVLLFTALALSWDLVARTGQLSLAHGAFFGLGAYGTGLLLPHVGTLPALALGALLAGLGALLLGSVTLRLHGLYFAIASLAFSEVLRTLALKLGFTGGPIGLPVPPPFGGGLPLAGYYLAFAVLALAVALSLWAEKSPFRLAQAACRQSEAVARVLGVRVVRVKLLSLFLGSLVAGLSGGVYAMKALFLSPYEAFSLARAVEALVIPIFGGLYTTLGPLLGGVVLVGLEQALRLWIQEGYLVVYGALLVLAILFLPKGLLGLLGGRRG GT:EXON 1|1-299:0| TM:NTM 7 TM:REGION 13->35| TM:REGION 52->74| TM:REGION 79->101| TM:REGION 145->167| TM:REGION 195->217| TM:REGION 235->257| TM:REGION 274->296| SEG 5->19|faflllfallpflpl| SEG 25->36|flldvglfvllf| SEG 79->95|alalgallaglgalllg| SEG 128->165|ggpiglpvpppfggglplagyylafavlalavalslwa| SEG 183->212|varvlgvrvvrvkllslflgslvaglsggv| SEG 241->259|gglyttlgpllggvvlvgl| SEG 270->282|gylvvygallvla| SEG 289->298|gllgllggrr| HM:PFM:NREP 1 HM:PFM:REP 33->282|PF02653|8.1e-30|28.2|248/267|BPD_transp_2| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 299-300| PSIPRED cHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHccccHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHcccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHcc //