[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS80698.1
DDBJ      :             hypothetical cytosolic protein
Swiss-Prot:RIMP_THET8   RecName: Full=Ribosome maturation factor rimP;

Homologs  Archaea  0/68 : Bacteria  254/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.38.2d.52.4
:157 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   12->139 1ib8A PDBj 2e-06 25.8 %
:RPS:SCOP  18->90 1ib8A2  d.52.4.1 * 3e-07 24.7 %
:RPS:SCOP  93->150 1ib8A1  b.38.2.1 * 7e-08 22.4 %
:HMM:SCOP  6->92 1ib8A2 d.52.4.1 * 3.7e-10 34.9 %
:RPS:PFM   22->133 PF02576 * DUF150 5e-14 46.8 %
:HMM:PFM   22->142 PF02576 * DUF150 2.2e-33 44.5 119/141  
:BLT:SWISS 1->157 RIMP_THET8 7e-90 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS80698.1 GT:GENE AAS80698.1 GT:PRODUCT hypothetical cytosolic protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(336042..336515) GB:FROM 336042 GB:TO 336515 GB:DIRECTION - GB:PRODUCT hypothetical cytosolic protein GB:PROTEIN_ID AAS80698.1 GB:DB_XREF GI:46196281 LENGTH 157 SQ:AASEQ MGVNPPFLCEGGGEVTVDLWQLVEEAVSPLGLDVLEVHFARGELLVRLERKDERPITVADLEEASRHIEAALDREDPIPGSYRLLVESPGPKRPLFTRRHFERFQGLKAKVPGPEGFTGRILRVEGEEVVFQVGDEERRLRIGTFRANLAEWPEEPR GT:EXON 1|1-157:0| SW:ID RIMP_THET8 SW:DE RecName: Full=Ribosome maturation factor rimP; SW:GN Name=rimP; OrderedLocusNames=TTHA0702; SW:KW Complete proteome; Cytoplasm; Ribosome biogenesis. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->157|RIMP_THET8|7e-90|100.0|157/157| GO:SWS:NREP 2 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0042254|"GO:ribosome biogenesis"|Ribosome biogenesis| BL:PDB:NREP 1 BL:PDB:REP 12->139|1ib8A|2e-06|25.8|128/164| RP:PFM:NREP 1 RP:PFM:REP 22->133|PF02576|5e-14|46.8|111/138|DUF150| HM:PFM:NREP 1 HM:PFM:REP 22->142|PF02576|2.2e-33|44.5|119/141|DUF150| RP:SCP:NREP 2 RP:SCP:REP 18->90|1ib8A2|3e-07|24.7|73/90|d.52.4.1| RP:SCP:REP 93->150|1ib8A1|7e-08|22.4|58/74|b.38.2.1| HM:SCP:REP 6->92|1ib8A2|3.7e-10|34.9|86/90|d.52.4.1|1/1|YhbC-like, N-terminal domain| OP:NHOMO 254 OP:NHOMOORG 254 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------1----------------1--------------1----1--------------------------------------------------------------------------------------------------11111------------------------------------------------------------------------------------------------------------------------------------------1---------------------------11----1--111----------1-11-------1----------11111111111------1--1-1-------1---111----1111-1111111111111------11--------------11----------------111--------------------------------------------------------------------------1-111--------1-----------1-1--------------------------11-111-11--1111111111111111111-----1111------11111111111111111-1111111111111111111111111111111111111111111111111111-111111111111--1111111111111111111111111111111-----------1-----------------111111111-111111111111111111111111-11111---------------------------------------------1---1-1-1--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 128 STR:RPRED 81.5 SQ:SECSTR ###########cccHHHHHHHHHHHHHHHHccEEEEEEEEETEEEEEEEEEccccccHHHHHHHHHHHGGGTTccccccccEEEEEEccccccccccHHHHHHEEEcccccccccEEEEEEEEEETTEEEEEEEccccE################## DISOP:02AL 1-3, 154-157| PSIPRED ccccccEEEccccHHHHHHHHHHHHHHHHcccEEEEEEEEcccEEEEEEEEccccccHHHHHHHHHHHHHHHcccccccccEEEEEEccccccccccHHHHHHHccEEEEEcccEEEEEEEEEEcccEEEEEEcccEEEEEEEccHHHHHccccccc //