[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS80717.1
DDBJ      :             hypothetical conserved protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:188 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   7->132 PF11306 * DUF3108 4.7e-11 27.8 126/207  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS80717.1 GT:GENE AAS80717.1 GT:PRODUCT hypothetical conserved protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION 354236..354802 GB:FROM 354236 GB:TO 354802 GB:DIRECTION + GB:PRODUCT hypothetical conserved protein GB:PROTEIN_ID AAS80717.1 GB:DB_XREF GI:46196300 LENGTH 188 SQ:AASEQ MKEVYRYAYHYAGRPVGEGRLEVERRRGGVRASLQAEFLPPLPPGRQRWQTELDAEGFSLRFQERVEGKEVRVFAVERLEEEGVVLVSQGKESLAYPYLAPYHDPLSLFLALPGLALEPGEVVRFPMPGGRVYVERLPDVEVEGKARRQYRLRPGLSLVQVEEGRLVRVAQQVGRHVFEAVLLEAEGP GT:EXON 1|1-188:0| SEG 13->31|grpvgegrleverrrggvr| SEG 76->87|verleeegvvlv| SEG 106->121|lslflalpglalepge| HM:PFM:NREP 1 HM:PFM:REP 7->132|PF11306|4.7e-11|27.8|126/207|DUF3108| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 187-188| PSIPRED ccccEEEEEEEcccccccccEEEEEccccEEEEEEEccccccccccEEEEEEHHHHHHHHHHHHHccccEEEEEEEEccccccEEEEEcccccccccEEEccccHHHHHHHHcccccccccEEEEEccccHHHHHHccccccccEEEEEEEEccccEEEEEccHHHHHHHHHHHHHHHHHHHEEcccc //