[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS80734.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:641 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   546->565 PF06708 * DUF1195 0.00037 55.0 20/157  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS80734.1 GT:GENE AAS80734.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(374162..376087) GB:FROM 374162 GB:TO 376087 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAS80734.1 GB:DB_XREF GI:46196317 LENGTH 641 SQ:AASEQ MRSFWPLLLLLALGVGLGQRLVLPEGAVAGGPLTLSGEGLPDGRYPLALEGPGGTRVEEVEVQGGRFALPLTLEAPGEYRVRLNLPSGALEGRFLLLAPTPPELTPEGLKLPWGLLPLPQGPWVGPLVEGERVYVAQGLLVVEAGLKEEAVRYHFAPAKVLALRPGPEALLEGERVLPIPFPPVPFQGKEEDLKALRPLLLALNPPRPWPYFAYWALPPETLSEEDLAAYGQDLRARGHRPELPFGQEGVLRMAEAARALLGEDPARAKALTLALLRYTPLFPGSEAFFREMAEALEAQGEVATALRLREALALSAPWRPPDLGFLAPAFFVLGTAYLALFLYLFLFYLPAQLKDLRPIGGYLGGFFRHPLLRLRHLHLAYAGLGERLLALLLFLATLAALLLYGLDAKARAALWAPPLDQGTLFTPAAQEWARSLPPTPGAKALQGYTLLRDNPTQARALLREGAPLPFALALLGEKELVLAYEKAPWSGPVRSLLGLGADPWGPREPAPTLRTLYTLLLEAEARRLAEDPWRGFSQLPLPLPEGYRAWAFAALLLLALYHLLTFFLPRRQGQPSPAYALFLRLLLPGSLGLGGGLGVVLLLLAAYGLWALLQGSSYLYLAAAYGLHLLLVLSSRAWRRA GT:EXON 1|1-641:0| TM:NTM 6 TM:REGION 8->30| TM:REGION 326->348| TM:REGION 382->404| TM:REGION 548->569| TM:REGION 583->605| TM:REGION 617->638| SEG 7->23|lllllalgvglgqrlvl| SEG 95->127|lllaptppeltpeglklpwgllplpqgpwvgpl| SEG 195->210|alrplllalnpprpwp| SEG 266->277|arakaltlallr| SEG 303->316|atalrlrealalsa| SEG 336->353|aylalflylflfylpaql| SEG 363->410|lggffrhpllrlrhlhlayaglgerllalllflatlaalllygldaka| SEG 466->475|aplpfalall| SEG 512->530|tlrtlytllleaearrlae| SEG 549->568|awafaallllalyhlltffl| SEG 580->635|alflrlllpgslglggglgvvllllaayglwallqgssylylaaayglhlllvlss| HM:PFM:NREP 1 HM:PFM:REP 546->565|PF06708|0.00037|55.0|20/157|DUF1195| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 640-641| PSIPRED ccHHHHHHHHHHHHcccccEEEccccccccccEEEccccccccccEEEEEccccccEEEEEEcccEEEEEEEEEccccEEEEEEccccccccEEEEEEcccccccccccccccccccccccccccccccccEEEEEccEEEEEcccHHHHHHEEcccEEEEEEcccHHHHHcccEEEccccccccccccHHHHHHHHHHHHccccccccccEEEEEccHHHccHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHccHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEccccccccEEccHHHHHHHccccccccHHHccEEEEcccHHHHHHHHHccccccEEHHHHcccEEEEEEEccccccHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHccccEEEHHHHHHHHHHHHHHHHHHccc //