[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS80736.1
DDBJ      :             sensory transduction protein kinase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.30.2b.1.18d.122.1
:324 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   257->322 1bxdA PDBj 2e-05 37.9 %
:RPS:PDB   257->322 1b3qA PDBj 2e-07 25.8 %
:RPS:SCOP  243->324 1oanA1  b.1.18.4 * 1e-06 11.7 %
:HMM:SCOP  98->185 2c2aA1 a.30.2.1 * 4.2e-12 36.4 %
:HMM:SCOP  185->325 1ysrA1 d.122.1.3 * 5e-23 34.8 %
:RPS:PFM   248->324 PF02518 * HATPase_c 3e-04 37.7 %
:HMM:PFM   229->305 PF02518 * HATPase_c 1.1e-13 33.8 77/111  
:HMM:PFM   38->111 PF00672 * HAMP 5.3e-10 35.3 68/70  
:HMM:PFM   117->182 PF00512 * HisKA 1.3e-08 36.4 66/68  
:BLT:SWISS 259->322 TORS_ECO57 2e-09 45.3 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS80736.1 GT:GENE AAS80736.1 GT:PRODUCT sensory transduction protein kinase GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(376813..377787) GB:FROM 376813 GB:TO 377787 GB:DIRECTION - GB:PRODUCT sensory transduction protein kinase GB:PROTEIN_ID AAS80736.1 GB:DB_XREF GI:46196319 LENGTH 324 SQ:AASEQ MSLRARLALVIALLAFLPNLVLALTLGALGEGPWPPLLLWLFLLALLSGLVGYFLAKSLLRPLEELTRALAYLSLKEGPLEALRLPTPKEPPPEEIALLRARFSELLARLKELLEAREALYAALAHDLKTPLLSALRLLDYLERADDLGKERRVALLRALREELARGYRLTENLLALARLEARPPRGETLNLRALAEDLLLRYRDEAKRRGLLLEVEGAGLARGERLLVERALANLLENALRHAKSRVRLRVGEGVFLVEDDGEGLPLPLEALARPFLQGEGRRGSAGLGLYTAKRVAEAHGGRLFPCEGPLGGACLGLELPKA GT:EXON 1|1-324:0| BL:SWS:NREP 1 BL:SWS:REP 259->322|TORS_ECO57|2e-09|45.3|64/914| TM:NTM 2 TM:REGION 7->29| TM:REGION 37->59| SEG 3->55|lrarlalviallaflpnlvlaltlgalgegpwpplllwlfllallsglvgyfl| SEG 105->125|ellarlkellearealyaala| SEG 151->183|errvallralreelargyrltenllalarlear| SEG 190->206|lnlralaedlllryrde| SEG 209->242|rrglllevegaglargerllveralanllenalr| BL:PDB:NREP 1 BL:PDB:REP 257->322|1bxdA|2e-05|37.9|66/161| RP:PDB:NREP 1 RP:PDB:REP 257->322|1b3qA|2e-07|25.8|66/368| RP:PFM:NREP 1 RP:PFM:REP 248->324|PF02518|3e-04|37.7|77/112|HATPase_c| HM:PFM:NREP 3 HM:PFM:REP 229->305|PF02518|1.1e-13|33.8|77/111|HATPase_c| HM:PFM:REP 38->111|PF00672|5.3e-10|35.3|68/70|HAMP| HM:PFM:REP 117->182|PF00512|1.3e-08|36.4|66/68|HisKA| GO:PFM:NREP 1 GO:PFM GO:0005524|"GO:ATP binding"|PF02518|IPR003594| RP:SCP:NREP 1 RP:SCP:REP 243->324|1oanA1|1e-06|11.7|77/97|b.1.18.4| HM:SCP:REP 98->185|2c2aA1|4.2e-12|36.4|88/0|a.30.2.1|1/1|Homodimeric domain of signal transducing histidine kinase| HM:SCP:REP 185->325|1ysrA1|5e-23|34.8|141/0|d.122.1.3|1/1|ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 82 STR:RPRED 25.3 SQ:SECSTR ##################################################################################################################################################################################################################################################TTccEEEEEGGGTEEEEEEccccccHHHHHHHHHccccccTTTccccccHHHHHHHHHTTcEEEEEEETTTEEEEEEEEEcc DISOP:02AL 1-2| PSIPRED ccHHHHHHHHHHHHHHccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEcHHHHHHHHHHHHHHHHHHccEEEEEccccEEEEcHHHHHHHHHHHHHHHHHHccccEEEEEEEEEEEEEEcccccHHHHHHHccccEEcccccccccHHHHHHHHHHHHcccEEEEEEcccccEEEEEEcccc //