[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS80738.1
DDBJ      :             iron(III) dicitrate-binding protein
Swiss-Prot:             

Homologs  Archaea  46/68 : Bacteria  471/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
c.92.2
:284 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   38->227 1n2zA PDBj 1e-16 31.0 %
:RPS:PDB   24->283 3be6B PDBj 3e-49 21.2 %
:RPS:SCOP  23->279 2chuA1  c.92.2.4 * 1e-50 20.8 %
:HMM:SCOP  10->286 2chuA1 c.92.2.4 * 8.3e-63 37.0 %
:RPS:PFM   39->254 PF01497 * Peripla_BP_2 5e-26 36.6 %
:HMM:PFM   39->254 PF01497 * Peripla_BP_2 5.4e-39 31.5 216/238  
:HMM:PFM   2->19 PF08525 * OapA_N 0.00091 44.4 18/30  
:BLT:SWISS 24->282 YVRC_BACSU 1e-31 31.1 %
:TM
:REPEAT 2|26->121|134->249
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS80738.1 GT:GENE AAS80738.1 GT:PRODUCT iron(III) dicitrate-binding protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION 379993..380847 GB:FROM 379993 GB:TO 380847 GB:DIRECTION + GB:PRODUCT iron(III) dicitrate-binding protein GB:PROTEIN_ID AAS80738.1 GB:DB_XREF GI:46196321 LENGTH 284 SQ:AASEQ MKRLLAALSVLLALAFAFPLTLQDDLGRTVTLKAPPKRIVTMLPSVTETVCALGACDRIVATDDYSDWPESVKRLPKAGGLYNPNPELIVSLKPDLVLVSKYGRLYETLERAGLTVYAVRTETYEDIFKTVRTLGRLLGLPAEAERLVAQIQKEVYQEEARAAKARSRPRVYYEIDPTPYTVGPESFIGVLISKARGVNIVPKELGLFPKISPEFVVEKDPEVIVATYPNALETIRSRPGWSRIQAVRTGRICVYTGGEASLLSRPGPRVAQALRLLVDCFHGR GT:EXON 1|1-284:0| BL:SWS:NREP 1 BL:SWS:REP 24->282|YVRC_BACSU|1e-31|31.1|254/314| TM:NTM 1 TM:REGION 4->26| NREPEAT 1 REPEAT 2|26->121|134->249| SEG 4->22|llaalsvllalafafpltl| BL:PDB:NREP 1 BL:PDB:REP 38->227|1n2zA|1e-16|31.0|187/245| RP:PDB:NREP 1 RP:PDB:REP 24->283|3be6B|3e-49|21.2|255/287| RP:PFM:NREP 1 RP:PFM:REP 39->254|PF01497|5e-26|36.6|216/235|Peripla_BP_2| HM:PFM:NREP 2 HM:PFM:REP 39->254|PF01497|5.4e-39|31.5|216/238|Peripla_BP_2| HM:PFM:REP 2->19|PF08525|0.00091|44.4|18/30|OapA_N| GO:PFM:NREP 2 GO:PFM GO:0005381|"GO:iron ion transmembrane transporter activity"|PF01497|IPR002491| GO:PFM GO:0006827|"GO:high-affinity iron ion transport"|PF01497|IPR002491| RP:SCP:NREP 1 RP:SCP:REP 23->279|2chuA1|1e-50|20.8|250/283|c.92.2.4| HM:SCP:REP 10->286|2chuA1|8.3e-63|37.0|273/0|c.92.2.4|1/1|"Helical backbone" metal receptor| OP:NHOMO 798 OP:NHOMOORG 518 OP:PATTERN 2211111111111112-1-1-33-11121211------1----1-433B172--11112311-1---- 11--11-1111-11--1----1---1-----------212-21--1----1---------11-2121-231-----------2----------------1--11-21-41---------------111111111-1333212133--------1------------12---------------3333311-1212222211212221121411322222325-1-22222242111111111111111111111-----------------------------------------------111---1-11-------------11-1111111111-----1222111--3---3212--21211211-13-311-----11113-1----21---1----------1-11111122111-1--321----2-1----212----21----------111--2------------------------------------221111222212111111111111112112212--11122111423211111121221---------1112-4412111111111----1---2---1-31151-42-2122-----------11-----221111112111111111311111121132---1111------212-1111222121211-211122212122211111111146222212112222222221231-211111-222232222333--1-----------111411111------1--3--11-11--131333311123----2111---------11--11111111232-----------------1221111--------1---------------------------1121112111--- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 261 STR:RPRED 91.9 SQ:SECSTR ######################EcTTccEEEcccccccEEEccTTTHHHHHHTTccccEEccEEcTTccEEcTTHHHHcccccccHHHHHHTcccEEEEcTccccHHHHHTTccEEEccccTTTTcHHHHHHHHHHHHTcHHHHHHHHHHHHHHHHHHHHHccGGGccEEEcEEETTEEEEcccHHHHHHHHHTTccccHHHHTccTcEEEcGGGGGGGcccEEEEEEHHHHHHHHHTTGGGGcHHHHTTcEEEEEEEEHHHHTcccHHHHHHHHHHHHHHHc# DISOP:02AL 284-285| PSIPRED cHHHHHHHHHHHHHHccccEEEEEccccEEEEcccccEEEEEccHHHHHHHHcccccEEEEEccHHHccHHHHHcccccccccccHHHHHHccccEEEEccccHHHHHHHHccccEEEEccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEEccccEEEcccccHHHHHHHHcccccccccccccccccHHHHHHccccEEEEEcccHHHHHHccccHHccHHHHcccEEEEcccHHHHHccccHHHHHHHHHHHHHHccc //