Thermus thermophilus HB27 (tthe0)
Gene : AAS80741.1
DDBJ      :             hypothetical protein

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:110 amino acids
:HMM:PFM   82->103 PF11367 * DUF3168 0.001 40.9 22/67  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS80741.1 GT:GENE AAS80741.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION 382592..382924 GB:FROM 382592 GB:TO 382924 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAS80741.1 GB:DB_XREF GI:46196324 LENGTH 110 SQ:AASEQ MSTWTRRARLFVRRRAFLLDLGEEVLFYTEGGPRRARYLLVGRVSPPEWLRLGLPREAVLHYPLEVDPLAFEWEGETLVLPGLRVYLGGPPEFVETPYYAWPLTGPRGRE GT:EXON 1|1-110:0| SEG 6->19|rrarlfvrrrafll| HM:PFM:NREP 1 HM:PFM:REP 82->103|PF11367|0.001|40.9|22/67|DUF3168| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 107-110| PSIPRED cccHHHHHHHHHHHHHHEEEcccEEEEEEccccccEEEEEEEccccHHHEEEcccHHHEEEcccccccEEEEEcccEEEEccEEEEEcccHHHHcccEEEEccccccccc //