[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS80743.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:91 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   49->81 PF09769 * ApoO 0.00062 33.3 33/158  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS80743.1 GT:GENE AAS80743.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION 383809..384084 GB:FROM 383809 GB:TO 384084 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAS80743.1 GB:DB_XREF GI:46196326 LENGTH 91 SQ:AASEQ MRVLGWFLLLVGLVLAWFLLSPVVALILALFALPLALLLAALALPVGLFLALLGAVLALLGFFVKWLLPLALLLLALWLLLSPRRPVPEGW GT:EXON 1|1-91:0| TM:NTM 3 TM:REGION 4->26| TM:REGION 36->58| TM:REGION 62->83| SEG 4->20|lgwflllvglvlawfll| SEG 22->64|pvvalilalfalplalllaalalpvglflallgavlallgffv| SEG 66->81|wllplallllalwlll| HM:PFM:NREP 1 HM:PFM:REP 49->81|PF09769|0.00062|33.3|33/158|ApoO| OP:NHOMO OP:NHOMOORG 0 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 87-91| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccc //