[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS80747.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:48 amino acids
:PSIPRED
:DISOPRED
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS80747.1 GT:GENE AAS80747.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(387007..387153) GB:FROM 387007 GB:TO 387153 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAS80747.1 GB:DB_XREF GI:46196330 LENGTH 48 SQ:AASEQ MKTRLGGGYLMERRPWTAMARAFLELIAYGLRVLLSLLPPPPGCKAIY GT:EXON 1|1-48:0| TM:NTM 1 TM:REGION 18->40| SEG 34->42|llsllpppp| OP:NHOMO 14 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------77------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3| PSIPRED cccccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccccccc //