[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS80756.1
DDBJ      :             O-acetyl-L-(homo)serine sulfhydrylase
Swiss-Prot:             

Homologs  Archaea  47/68 : Bacteria  743/915 : Eukaryota  186/199 : Viruses  0/175   --->[See Alignment]
c.67.1
:421 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   1->421 2ctzA PDBj 0.0 99.5 %
:RPS:PDB   1->421 2ctzA PDBj 3e-70 89.3 %
:RPS:SCOP  2->421 1cs1A  c.67.1.3 * 9e-60 28.3 %
:HMM:SCOP  1->421 2ctzA1 c.67.1.3 * 2.3e-127 40.9 %
:RPS:PFM   5->421 PF01053 * Cys_Met_Meta_PP 3e-81 47.3 %
:HMM:PFM   4->420 PF01053 * Cys_Met_Meta_PP 1.5e-135 47.5 383/386  
:BLT:SWISS 2->421 CYSD_EMENI e-115 55.6 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS80756.1 GT:GENE AAS80756.1 GT:PRODUCT O-acetyl-L-(homo)serine sulfhydrylase GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(396021..397286) GB:FROM 396021 GB:TO 397286 GB:DIRECTION - GB:PRODUCT O-acetyl-L-(homo)serine sulfhydrylase GB:PROTEIN_ID AAS80756.1 GB:DB_XREF GI:46196339 LENGTH 421 SQ:AASEQ MRFETLQLHAGYEPEPTTLSRQVPIYPTTSYVFKSPEHAANLFALKEFGNIYSRIMNPTVDVLEKRLAALEGGKAALATASGHAAQFLALTTLAQAGDNIVSTPNLYGGTFNQFKVTLKRLGIEVRFTSREERPEEFLALTDERTRAWWVESIGNPALNIPDLEALAQAAREKGVALIVDNTFGMGGYLLRPLAWGAALVTHSLTKWVGGHGAVIAGAIVDGGSFPWEGGRYPLLTEPQPGYHGLRLTEAFGELAFIVKARVDGLRDQGQALGPFEAWVVLLGMETLSLRAERHVENTLHLAHWLLEQPQVAWVNYPGLPHHPHHDRAQKYFKGKPGAVLTFGLKGGYEAAKRFISRLKLISHLANVGDTRTLAIHPASTTHSQLSPEEQAQAGVSPEMVRLSVGLEHVEDLKAELKEALA GT:EXON 1|1-421:0| BL:SWS:NREP 1 BL:SWS:REP 2->421|CYSD_EMENI|e-115|55.6|419/437| SEG 67->80|laaleggkaalata| SEG 84->96|aaqflalttlaqa| SEG 208->223|vgghgaviagaivdgg| BL:PDB:NREP 1 BL:PDB:REP 1->421|2ctzA|0.0|99.5|421/421| RP:PDB:NREP 1 RP:PDB:REP 1->421|2ctzA|3e-70|89.3|421/421| RP:PFM:NREP 1 RP:PFM:REP 5->421|PF01053|3e-81|47.3|383/384|Cys_Met_Meta_PP| HM:PFM:NREP 1 HM:PFM:REP 4->420|PF01053|1.5e-135|47.5|383/386|Cys_Met_Meta_PP| GO:PFM:NREP 2 GO:PFM GO:0006520|"GO:cellular amino acid metabolic process"|PF01053|IPR000277| GO:PFM GO:0030170|"GO:pyridoxal phosphate binding"|PF01053|IPR000277| RP:SCP:NREP 1 RP:SCP:REP 2->421|1cs1A|9e-60|28.3|378/384|c.67.1.3| HM:SCP:REP 1->421|2ctzA1|2.3e-127|40.9|421/0|c.67.1.3|1/1|PLP-dependent transferases| OP:NHOMO 2698 OP:NHOMOORG 976 OP:PATTERN 22-1-11111111111-111111-3332233321--------1451-1-1221-111-1--2221--- 174-421233222143333-33223533333244443567133355423442436556--214-332314346664441-131-----33222211---11435442344---------------2323322431144444---43---2--2--11222221----2-1-22222222222234322--12435555555555555556633435553453511333333752333333333333323334411-11113-1-331112-1-253323-------222122221211111111111111111122333222-241573333333231227721113241-5333-22--1-24233332-315-33335-----24955542C567544444443446-45654734483-5555666658663334433345443452222222242223258-------------------------111-134432364335222363333322373333-332454341143333344634654323111243222222222244221123-1-241----565354423334342112221122212-12111111123121113332314423224344334333433344331--3321------42322332222222222-2222222232222222223333333362222222222222222422222222-2--11111111121-311111111112214333324-111-2223222222212231333344251555324221--------11222222222342233232333331111113122--11--------1----------------------------11--22222-22 ----112-421-2323343334333333333333533333333333333336644434333333333313323333323333333322-47333372111223433-2614151121111111122--1362-21311111112111--111111111111134231112133423235n3333455684523342225 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 421 STR:RPRED 100.0 SQ:SECSTR ccHHHHHHHTTccccTTTcccccccccccccccccHHHHHHHHTTTTGGGcccccccHHHHHHHHHHHHHHTccEEEEEccHHHHHHHHHTTccTTTcEEEEEccccHHHHHHHHHHHHHHccEEEEEcTTccHHHHHHHccTTEEEEEEEcccTTTcccccHHHHHHHHHHTTcEEEEEcccGccTTTccGGGGTccEEEEETTTTTTcccccccEEEEEccccccTTTTcHHHHcccGTccccccEEEEcccHHHHHHHHHHHHHHcccccHHHHHHHHHHHTTHHHHHHHHHHHHHHHHHHHHTcTTEEEEEcTTcTTcTTHHHHHHHcccccccEEEEEETTHHHHHHHHHHHccccEEcccccccccEEEcTTTTTTcccccTTTTTccccccEEEEEcccccHHHHHHHHTTcTc PSIPRED ccHHHHHHHccccccccccccccccccccEEEcccHHHHHHHHccccccccccccccccHHHHHHHHHHHHcccEEEEEcccHHHHHHHHHHHcccccEEEEccccccHHHHHHHHHHHHccEEEEEEcccccHHHHHHHcccccEEEEEEcccccccccccHHHHHHHHHHcccEEEEEcccccccccccHHHHcccEEEEcccccccccccccEEEEEEccccHHHHccHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHccccEEEEEcccccccccHHHHHHHccccccEEEEEEEcccHHHHHHHHHHcccEEEEcccccccEEEEEccccccccccHHHHHHccccccEEEEEEEcccHHHHHHHHHHHHc //