[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS80764.1
DDBJ      :             tripartite transporter, large subunit
Swiss-Prot:             

Homologs  Archaea  3/68 : Bacteria  356/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
:437 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   153->273 3d31C PDBj 5e-04 26.5 %
:RPS:PFM   12->426 PF06808 * DctM 2e-67 45.0 %
:HMM:PFM   11->425 PF06808 * DctM 3.4e-102 35.0 409/416  
:BLT:SWISS 3->434 SIAT_HAEI8 3e-40 29.6 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS80764.1 GT:GENE AAS80764.1 GT:PRODUCT tripartite transporter, large subunit GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION 403607..404920 GB:FROM 403607 GB:TO 404920 GB:DIRECTION + GB:PRODUCT tripartite transporter, large subunit GB:PROTEIN_ID AAS80764.1 GB:DB_XREF GI:46196347 LENGTH 437 SQ:AASEQ MPIETLTWLMFGALFVLLLTGYPLAFLVGGLSVVFIAWLWSPDALALVPQRVWNNMTQYLLAAIPLFIFMASMLEKSGVIEEVFDVAYKWLGRIPGGLAVATVVASTVLAAMVGVIGAAVVTMALVALPSMLRRGYSPVLAVGTVMAGGTLGILIPPSVLAIVYGLVANQSVGELYLGSVFPGLVLSGLYILFSVGYALLNPKAAPRLSPEETPTWSERWRALRSIWSPLVLIFLVLGTIFLGLAAPTEAAAIGAFGAMVVAAIHRRLSWTILRLALEQTAKATAMVMWIVFGANAFVGFYIAQGGDRYVSELLLGTGLSPWGILLLMQGILIVLGMFLDWVGILLLAVPVFVPIIRDLGFDPLWFGVLYLVNMQISFLSPPFGYALFYVRGVAPQVPMGTIYKAALPFLFLQLVGLALVMLFPGLATWLPSVVYGR GT:EXON 1|1-437:0| BL:SWS:NREP 1 BL:SWS:REP 3->434|SIAT_HAEI8|3e-40|29.6|415/616| TM:NTM 10 TM:REGION 14->36| TM:REGION 55->77| TM:REGION 102->124| TM:REGION 141->163| TM:REGION 176->198| TM:REGION 234->256| TM:REGION 282->304| TM:REGION 322->344| TM:REGION 367->389| TM:REGION 408->430| SEG 98->124|lavatvvastvlaamvgvigaavvtma| BL:PDB:NREP 1 BL:PDB:REP 153->273|3d31C|5e-04|26.5|113/248| RP:PFM:NREP 1 RP:PFM:REP 12->426|PF06808|2e-67|45.0|409/412|DctM| HM:PFM:NREP 1 HM:PFM:REP 11->425|PF06808|3.4e-102|35.0|409/416|DctM| OP:NHOMO 1133 OP:NHOMOORG 362 OP:PATTERN --1-------------------------1-------------------------------1------- -------11121-------------2------------------1-1-------1-----------1---1----------------------1----------1---1-------------------------1111111-----111-11--------1-1-1--11-1-1-----1-------3311-------------------8311------11-6------------------------------1----------------------------------------------------------------------71-----------------------2--11-145-2-1--21-----2-----11--------D991136345511111111116-22321413A12-2882338634CE84212IIF9ACDJEN--------2----421-----------------------------3-----2MH9H2111111----223------2113526313---A376655K8D53232---13--------1-464-3G374741-6332-1211-111-1111---3122-1-------1-------12311------334-3-A21111-1-111111--114---1212------21--11-1--3133322--212333131-22111116---1111-3-323223333232222---222---111111111111---1----------27GR---714-2322-336-------11-113333-112711125121---------2--163333333546--11111---------2-11------------1--------------------------------11121--- --------------------------------------------------------------------------------------------------------------------------------------------------------------1----1------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 113 STR:RPRED 25.9 SQ:SECSTR ########################################################################################################################################################GTccHHHHHHHHcTTTGGGTTTcccTTcHHHHHHHHHHH##HHHHHHHHHHHHHHHHHHHHHTTccHHHHHHHTHHHHHHHHHHHHHHH######HHHHHHTccHHHHHHHcTTccHHHHH#################################################################################################################################################################### DISOP:02AL 209-210| PSIPRED ccHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHcccHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //