[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS80769.1
DDBJ      :             ABC transporter substrate-binding protein (taurine)
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  158/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
c.94.1
:329 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   113->213 1wdnA PDBj 5e-04 30.9 %
:RPS:PDB   48->198 1blfA PDBj 7e-21 10.1 %
:RPS:SCOP  56->191 1us4A  c.94.1.1 * 3e-17 17.6 %
:HMM:SCOP  28->259 1xs5A_ c.94.1.1 * 3.6e-38 33.3 %
:RPS:PFM   56->201 PF09084 * NMT1 3e-14 38.6 %
:HMM:PFM   45->252 PF09084 * NMT1 8.3e-29 29.6 203/216  
:BLT:SWISS 48->182 Y357_HAEIN 2e-11 32.1 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS80769.1 GT:GENE AAS80769.1 GT:PRODUCT ABC transporter substrate-binding protein (taurine) GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(409842..410831) GB:FROM 409842 GB:TO 410831 GB:DIRECTION - GB:PRODUCT ABC transporter substrate-binding protein (taurine) GB:PROTEIN_ID AAS80769.1 GB:DB_XREF GI:46196352 LENGTH 329 SQ:AASEQ MSCCVDRREVIQGIAGLALGGVALGQRGRKKLRLAFCSQLLCIVPYEVAQRRGYFAEEGLEVELVYARGGSQALQFLVGKAVDYAATSLDAALQAYHRGAPILRFASTGRLPLFALAAGPKSPVKSVRDLEGKTVGVSALGNADHVLLVYLLKKAGVDPKRVQYATLGPNLYEALKAGHVEAGMVQEPALSLLKEAGGRELVNLMDLRQARTYLGGPYEFMGVAVRREERQERLEEMRALSRALAKALRFIHAADARLIADTLPKALIAGGDEERLKAVIQRYRKDLYPEDVRIDLEAARRVVESQQEAGLLPPSFRLEGLLDLEVLGA GT:EXON 1|1-329:0| BL:SWS:NREP 1 BL:SWS:REP 48->182|Y357_HAEIN|2e-11|32.1|134/314| SEG 10->29|viqgiaglalggvalgqrgr| SEG 226->249|rreerqerleemralsralakalr| BL:PDB:NREP 1 BL:PDB:REP 113->213|1wdnA|5e-04|30.9|94/223| RP:PDB:NREP 1 RP:PDB:REP 48->198|1blfA|7e-21|10.1|148/685| RP:PFM:NREP 1 RP:PFM:REP 56->201|PF09084|3e-14|38.6|145/200|NMT1| HM:PFM:NREP 1 HM:PFM:REP 45->252|PF09084|8.3e-29|29.6|203/216|NMT1| RP:SCP:NREP 1 RP:SCP:REP 56->191|1us4A|3e-17|17.6|136/298|c.94.1.1| HM:SCP:REP 28->259|1xs5A_|3.6e-38|33.3|219/0|c.94.1.1|1/1|Periplasmic binding protein-like II| OP:NHOMO 243 OP:NHOMOORG 161 OP:PATTERN -----------------------1-------------------------------------------- ----------------------------------1--3----------------1---------2111--------------1------------------------------------------------------------------------------------------------------11----1--11111--11111--1--11--11---------------1----------------------------------------------------------------------------------------------1-----------------------1-------1--1--1--------------------1323--12-23-1111111-112-1141131122--5221112121--53---1-22222-11---------11-1--1-----------------------------------121-12222221111122431111112253433--442--2--212421-------1------------1-----1-1---1---------------------------------------------------------------------------------------------1---------------------------------------------------------------------111--1-1-------------------1-111-----11----111--1-----1--------11-1--1-------------1111-------1----1---------------------------------------------------------------------- ---------------------------------------------------------------------------------------1----------------------------------------------------------------------1---------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 287 STR:RPRED 87.2 SQ:SECSTR #############################ccEEEEEccHHHHHHHHHHHHHHHHGGGccccEEEEEcccHHHHHHHHHTTccccEEEcHHHHHHHHcTTTcEEEccccEEcEEEEEEEEEcccccccTTcTTccEEEccTTTTTTHHHHHHHHHHHTccTTTccHHHHHHHHHTTcccEEcTTccTTTcGGGcTTcccGTTccHHHHcccccHHHHcTTHHEEEEEEEEGGGcHHHHHHHHHHHHHHHHHHHHcGGGGGGHHHHHHHcTTccHHHHHHHHHHHccHHHHccHHHHHHHHHHHHHHHHHTTcccccc############# DISOP:02AL 1-5| PSIPRED cccHHHHHHHHHHHHHHHHHHcccccccccEEEEEEEcccccHHHHHHHHHccHHHHcccEEEEEEcccHHHHHHHHHcccEEEEEEcccHHHHHHHccccEEEEEEEcccccEEEEEEcccccccHHHHcccEEEEEccccHHHHHHHHHHHHccccHHHEEEEEccHHHHHHHHcccEEEEEEccHHHHHHHHccccEEEEccccccccHHccccccEEEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHccccccHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHcccccccccHHHHHHHHcccc //