[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS80773.1
DDBJ      :             hypothetical conserved protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.52.1
:159 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   62->132 1wdjB PDBj 1e-05 42.3 %
:RPS:SCOP  12->148 1wdjA  c.52.1.27 * 4e-14 26.3 %
:HMM:SCOP  12->157 1wdjA_ c.52.1.27 * 1.1e-21 26.2 %
:HMM:PFM   32->130 PF05685 * DUF820 8.4e-17 25.3 99/111  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS80773.1 GT:GENE AAS80773.1 GT:PRODUCT hypothetical conserved protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(414633..415112) GB:FROM 414633 GB:TO 415112 GB:DIRECTION - GB:PRODUCT hypothetical conserved protein GB:PROTEIN_ID AAS80773.1 GB:DB_XREF GI:46196356 LENGTH 159 SQ:AASEQ MLKQLLEADAIGLRLEWVGGLPLWEAQPTYRHQKAVDRIRQSIRPKEGASCACVHVADVYVRFPDGSYKRPDIAIFCREPEELDEAITLLPEAVVEVVSRGYEAKDLEIGPRFYLSQGVKDVVVFDPYTLLVLHLRRDGASRYVSPVELELEAGCLLTV GT:EXON 1|1-159:0| BL:PDB:NREP 1 BL:PDB:REP 62->132|1wdjB|1e-05|42.3|71/152| HM:PFM:NREP 1 HM:PFM:REP 32->130|PF05685|8.4e-17|25.3|99/111|DUF820| RP:SCP:NREP 1 RP:SCP:REP 12->148|1wdjA|4e-14|26.3|137/186|c.52.1.27| HM:SCP:REP 12->157|1wdjA_|1.1e-21|26.2|145/0|c.52.1.27|1/1|Restriction endonuclease-like| OP:NHOMO 5 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------12---------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 71 STR:RPRED 44.7 SQ:SECSTR #############################################################EcTTccEEcccEEEEEHHHHTccHHHHccccEEEEEccTTccHHHHHHHHHHHHHTTccEEEEEETTTTEE########################### DISOP:02AL 159-160| PSIPRED cHHHHHcccccccEEEEEccEEEEcccccHHHHHHHHHHHHHHHHHHcccccEEEEcccEEEEccccEEEccEEEEEcccHHHcccccccccEEEEEEcccccHHHHHHHHHHHHHccccEEEEEcccccEEEEEEEcccccEEEEEEEEcccccEEcc //