[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS80774.1
DDBJ      :             dihydroorotase
Swiss-Prot:PYRC_THEAQ   RecName: Full=Dihydroorotase;         Short=DHOase;         EC=3.5.2.3;

Homologs  Archaea  63/68 : Bacteria  702/915 : Eukaryota  133/199 : Viruses  0/175   --->[See Alignment]
b.92.1c.1.9
:426 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->426 2z00A PDBj 0.0 98.3 %
:RPS:PDB   2->423 3dc8B PDBj 5e-41 22.2 %
:RPS:SCOP  1->78 1ymyA1  b.92.1.5 * 1e-14 15.4 %
:RPS:SCOP  50->367 1gkrA2  c.1.9.6 * 5e-59 26.6 %
:RPS:SCOP  340->421 2i9uA1  b.92.1.4 * 1e-09 6.2 %
:HMM:SCOP  1->89 1onwA1 b.92.1.7 * 2.1e-15 33.0 %
:HMM:SCOP  50->371 1k1dA2 c.1.9.6 * 6.4e-95 51.6 %
:HMM:SCOP  322->423 1ynyA1 b.92.1.3 * 1.7e-05 25.5 %
:RPS:PFM   49->100 PF01979 * Amidohydro_1 5e-10 53.8 %
:HMM:PFM   47->382 PF01979 * Amidohydro_1 4.2e-14 21.5 275/328  
:BLT:SWISS 1->426 PYRC_THEAQ 0.0 95.5 %
:PROS 53->61|PS00482|DIHYDROOROTASE_1
:PROS 304->315|PS00483|DIHYDROOROTASE_2
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS80774.1 GT:GENE AAS80774.1 GT:PRODUCT dihydroorotase GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(415117..416397) GB:FROM 415117 GB:TO 416397 GB:DIRECTION - GB:PRODUCT dihydroorotase GB:PROTEIN_ID AAS80774.1 GB:DB_XREF GI:46196357 LENGTH 426 SQ:AASEQ MILIRNVRLVDARGERGPADVLIGEGRILSLEGGEAKQVVDGTGCFLAPGFLDLHAHLREPGEEVKEDLFSGLLAAVRGGYTDLVSMPNTKPPVDTPEAVRALKEKAKALGLARLHPAAALTEKQEGKTLTPAGLLQEAGAVLLTDDGRTNEDAGVLAAGLLMAAPLGLPVAVHAEDAGLRRNGVMNDGPLADLLGLPGNPPEAEAARIARDLEVLRYASRRSPATPRLHVQHLSTKRGLELIREAKRAGLPVTAEATPHHLTLTEEALRAFNPLFKVAPPLRGEEDREALLEGLLDGTLDAIATDHAPHTLAEKEKDLLRAPFGIPSLEVAFPLLYTELHLKRGFPLPRLVELFTDGPRRVLGLPPLHLEEGAEASLVLLSPKERPVDPSAFASKARYSPWAGWVLGGWPVLTLVAGRIVHEALK GT:EXON 1|1-426:0| SW:ID PYRC_THEAQ SW:DE RecName: Full=Dihydroorotase; Short=DHOase; EC=3.5.2.3; SW:GN Name=pyrC; SW:KW Hydrolase; Metal-binding; Pyrimidine biosynthesis; Zinc. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->426|PYRC_THEAQ|0.0|95.5|426/426| GO:SWS:NREP 3 GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0006221|"GO:pyrimidine nucleotide biosynthetic process"|Pyrimidine biosynthesis| PROS 53->61|PS00482|DIHYDROOROTASE_1|PDOC00401| PROS 304->315|PS00483|DIHYDROOROTASE_2|PDOC00401| SEG 102->115|alkekakalglarl| SEG 154->173|agvlaagllmaaplglpvav| SEG 187->202|ndgpladllglpgnpp| BL:PDB:NREP 1 BL:PDB:REP 2->426|2z00A|0.0|98.3|422/422| RP:PDB:NREP 1 RP:PDB:REP 2->423|3dc8B|5e-41|22.2|418/474| RP:PFM:NREP 1 RP:PFM:REP 49->100|PF01979|5e-10|53.8|52/271|Amidohydro_1| HM:PFM:NREP 1 HM:PFM:REP 47->382|PF01979|4.2e-14|21.5|275/328|Amidohydro_1| GO:PFM:NREP 1 GO:PFM GO:0016787|"GO:hydrolase activity"|PF01979|IPR006680| RP:SCP:NREP 3 RP:SCP:REP 1->78|1ymyA1|1e-14|15.4|78/85|b.92.1.5| RP:SCP:REP 50->367|1gkrA2|5e-59|26.6|308/325|c.1.9.6| RP:SCP:REP 340->421|2i9uA1|1e-09|6.2|80/109|b.92.1.4| HM:SCP:REP 1->89|1onwA1|2.1e-15|33.0|88/106|b.92.1.7|1/1|Composite domain of metallo-dependent hydrolases| HM:SCP:REP 50->371|1k1dA2|6.4e-95|51.6|316/332|c.1.9.6|1/1|Metallo-dependent hydrolases| HM:SCP:REP 322->423|1ynyA1|1.7e-05|25.5|102/0|b.92.1.3|1/1|Composite domain of metallo-dependent hydrolases| OP:NHOMO 1368 OP:NHOMOORG 898 OP:PATTERN 11212111111111131111---12111213111111111111111111111111111111-111-11 1131211111111111111-1211121111111111111213232221111122321111112141333322111111211151111111111111---12222242212---------------11111111111111111111122222212222---1--11222222111-------1-122111111121111111111111112222121111212111111111131111111111111112111131-111111111111111111111111111111111111111111111111111111111111111111112213222222222213221111231311212175121111221111111112222222222224542222222222332333333-22422423432142233326533242-22244333322233333333233222121111111111---------------11112112123221-2443421111122232221214232233--221111111131421121111---------11111111111111111111111111111111111312-111111111-1111111111111-22211-1-2-----------1--------------1111------1---1--2222222222-122222222212222222---2-----1-111-1111111111-1---------------------------------123-1---------------11111121111-333333332132211111111111112---1-----1----11111111111111--12111111--------1--------------------1------1121111111311 ----32--211----4-313-121213--1---1111111111--------1-111------12111111-121111111211111---122-111--112--111-1324142242111111121-11261-211-1--1111--11--1--3111-4--11212222251141-11-I--1114112212--1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 426 STR:RPRED 100.0 SQ:SECSTR cEEEEccEEEccccEEEEcEEEEETTEEEEEccccccEEEEcTTcEEEEcEEEEEEcTTcEETTEcccHHHHHHHHHHTTEEEEEEEEccccccHHHHHHHHHHHTTTcccEEEEEEEEccccHHHHHHHHHHHHHcccEEEEcccTTTTcccHHHHHHHHHHHHHHTcEEEEEcccHHHHHHHHHHHHHTTcccHHHHHHccHTccHHHHHHHHHHHHHHHHHHTccEEEcccccHHHHHHHHHHHHTTccEEEcccHHHHHccGGccHHHHHHTccccccccGGGHHHHHHHHHHTcccccccccccccHHGGTTcGGGcccccccTTTHHHHHHHHHTTTTcccHHHHHHHHTHHHHHHTTcTTTcccTTccccEEEEEEEEEEccGGGccccccccTTTTcEEEEEEEEEEETTEEEEEGcc DISOP:02AL 424-426| PSIPRED cEEEEEEEEEcccccEEEEEEEEEccEEEEEccccccEEEEccccEEEccccccHHHHccccccccccHHHHHHHHHHcccEEEEEccccccccccHHHHHHHHHHHHHccccEEEEEEEEEccccHHHHHHHHHHHHHcEEEEEccccccccHHHHHHHHHHHHHcccEEEEEcccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHcccccccEEEEEEccHHHHHHHHHHHHcccEEEEEEcccEEEccHHHHHHcccEEEEcccccccccHHHHHHHHHccccEEEEEccccccHHHHcccHHHccccccHHHHHHHHHHHHHHHHccccHHHHHHHHHcccHHHHccccccccccccEEEEEEcccccEEcHHHHHHccccccccccEEEEEEEEEEEccEEEEEccc //