[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS80777.1
DDBJ      :             hypothetical membrane spanning protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  15/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:109 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   6->36 PF03779 * SPW 2e-07 67.7 %
:RPS:PFM   58->86 PF03779 * SPW 2e-06 69.0 %
:HMM:PFM   6->52 PF03779 * SPW 4.1e-22 53.2 47/51  
:HMM:PFM   57->106 PF03779 * SPW 4.2e-26 58.0 50/51  
:TM
:REPEAT 2|4->34|56->86
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS80777.1 GT:GENE AAS80777.1 GT:PRODUCT hypothetical membrane spanning protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(418045..418374) GB:FROM 418045 GB:TO 418374 GB:DIRECTION - GB:PRODUCT hypothetical membrane spanning protein GB:PROTEIN_ID AAS80777.1 GB:DB_XREF GI:46196360 LENGTH 109 SQ:AASEQ MRKWQDWANLVLGLWLVLSPWILGFSGTSSATWNAVLLGLAVGLLSLLHLQGGPLWEEWANVVLGVWLILSPWILGFSGEADATWNAVIVGLLVGLLALSVAREKPKTA GT:EXON 1|1-109:0| TM:NTM 4 TM:REGION 4->26| TM:REGION 29->51| TM:REGION 56->78| TM:REGION 83->103| NREPEAT 1 REPEAT 2|4->34|56->86| SEG 37->55|llglavgllsllhlqggpl| SEG 87->102|avivgllvgllalsva| RP:PFM:NREP 2 RP:PFM:REP 6->36|PF03779|2e-07|67.7|31/50|SPW| RP:PFM:REP 58->86|PF03779|2e-06|69.0|29/50|SPW| HM:PFM:NREP 2 HM:PFM:REP 6->52|PF03779|4.1e-22|53.2|47/51|SPW| HM:PFM:REP 57->106|PF03779|4.2e-26|58.0|50/51|SPW| OP:NHOMO 17 OP:NHOMOORG 15 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------1---1--1-------113---11-------1-----------------------------------------------------------------------------------------------------1-1-1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 105-109| PSIPRED cccHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHcccccc //