[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS80783.1
DDBJ      :             glutaryl-CoA dehydrogenase
Swiss-Prot:             

Homologs  Archaea  30/68 : Bacteria  518/915 : Eukaryota  165/199 : Viruses  0/175   --->[See Alignment]
a.29.3e.6.1
:385 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->385 2ebaA PDBj 0.0 99.7 %
:RPS:PDB   1->385 2ebaA PDBj 1e-79 93.7 %
:RPS:SCOP  3->231 1siqA2  e.6.1.1 * 8e-63 46.3 %
:RPS:SCOP  234->385 1siqA1  a.29.3.1 * 1e-33 56.6 %
:HMM:SCOP  5->230 1jqiA2 e.6.1.1 * 5.3e-75 40.0 %
:HMM:SCOP  231->381 1bucA1 a.29.3.1 * 4.9e-39 35.1 %
:RPS:PFM   14->124 PF02771 * Acyl-CoA_dh_N 2e-12 36.0 %
:RPS:PFM   129->180 PF02770 * Acyl-CoA_dh_M 4e-09 49.0 %
:RPS:PFM   233->379 PF00441 * Acyl-CoA_dh_1 2e-18 35.4 %
:HMM:PFM   12->124 PF02771 * Acyl-CoA_dh_N 1.1e-35 46.9 113/113  
:HMM:PFM   233->379 PF00441 * Acyl-CoA_dh_1 7e-32 34.7 147/150  
:HMM:PFM   128->178 PF02770 * Acyl-CoA_dh_M 4.4e-23 54.0 50/52  
:BLT:SWISS 3->385 GCDH_HUMAN 3e-98 50.1 %
:PROS 130->142|PS00072|ACYL_COA_DH_1
:PROS 338->357|PS00073|ACYL_COA_DH_2
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS80783.1 GT:GENE AAS80783.1 GT:PRODUCT glutaryl-CoA dehydrogenase GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(423786..424943) GB:FROM 423786 GB:TO 424943 GB:DIRECTION - GB:PRODUCT glutaryl-CoA dehydrogenase GB:PROTEIN_ID AAS80783.1 GB:DB_XREF GI:46196366 LENGTH 385 SQ:AASEQ MLDFYALEDLLTPEEKEVQKAARRFLEKEALPHIRDWWEEGVFPTHLIPRFAELGFLGPTLPPEYGGAGVSSAAYGLICYELERVDSGLRSFVSVQSSLVMYPIYAYGSEEQKREFLPKLARGEMVGCFGLTEPDGGSDPYGNMKTRARREGDTWVLNGTKMWITNGNLAHLAVIWAKDEGGEVLGFLVPTDTPGFQAREVKRKMSLRASVTSELVLEEVRVPESLRLPKALGLKAPLSCLTQARFGIAWGAMGALEAVYEEAVAFAKSRQTFGEPLAKKQLVQAKLAEMLAWHTEGLLLAWRLARLKDEGKLTPAQVSLAKRQNVWKALQAARMARDILGGSGITLEYHAIRHMLNLETVYTYEGTHDVHTLVLGREITGLNAF GT:EXON 1|1-385:0| BL:SWS:NREP 1 BL:SWS:REP 3->385|GCDH_HUMAN|3e-98|50.1|381/438| PROS 130->142|PS00072|ACYL_COA_DH_1|PDOC00070| PROS 338->357|PS00073|ACYL_COA_DH_2|PDOC00070| SEG 65->76|yggagvssaayg| BL:PDB:NREP 1 BL:PDB:REP 1->385|2ebaA|0.0|99.7|380/380| RP:PDB:NREP 1 RP:PDB:REP 1->385|2ebaA|1e-79|93.7|380/380| RP:PFM:NREP 3 RP:PFM:REP 14->124|PF02771|2e-12|36.0|111/113|Acyl-CoA_dh_N| RP:PFM:REP 129->180|PF02770|4e-09|49.0|51/53|Acyl-CoA_dh_M| RP:PFM:REP 233->379|PF00441|2e-18|35.4|147/150|Acyl-CoA_dh_1| HM:PFM:NREP 3 HM:PFM:REP 12->124|PF02771|1.1e-35|46.9|113/113|Acyl-CoA_dh_N| HM:PFM:REP 233->379|PF00441|7e-32|34.7|147/150|Acyl-CoA_dh_1| HM:PFM:REP 128->178|PF02770|4.4e-23|54.0|50/52|Acyl-CoA_dh_M| GO:PFM:NREP 6 GO:PFM GO:0003995|"GO:acyl-CoA dehydrogenase activity"|PF02771|IPR006092| GO:PFM GO:0055114|"GO:oxidation reduction"|PF02771|IPR006092| GO:PFM GO:0003995|"GO:acyl-CoA dehydrogenase activity"|PF02770|IPR006091| GO:PFM GO:0055114|"GO:oxidation reduction"|PF02770|IPR006091| GO:PFM GO:0016627|"GO:oxidoreductase activity, acting on the CH-CH group of donors"|PF00441|IPR006090| GO:PFM GO:0055114|"GO:oxidation reduction"|PF00441|IPR006090| RP:SCP:NREP 2 RP:SCP:REP 3->231|1siqA2|8e-63|46.3|227/236|e.6.1.1| RP:SCP:REP 234->385|1siqA1|1e-33|56.6|152/154|a.29.3.1| HM:SCP:REP 5->230|1jqiA2|5.3e-75|40.0|225/231|e.6.1.1|1/1|Acyl-CoA dehydrogenase NM domain-like| HM:SCP:REP 231->381|1bucA1|4.9e-39|35.1|151/151|a.29.3.1|1/1|Acyl-CoA dehydrogenase C-terminal domain-like| OP:NHOMO 6350 OP:NHOMOORG 713 OP:PATTERN 44----6688A88977-243532D96661-7B-----------------------------4651--- 4556R3-5111846U*kKK-Kj44kkKKKKKUijrjXj**4X9e1133-11-667668--EER1EERJIJE--------374B-----11111122---41445564545--------------------------67688---B3-1-1--1---------------13-------------78878--1D735555545555555553555545557BA9B11------52-111111-11111112---1--1------------------------------------------------------------------111315444444444423222221-6-3-5-13-891596-17---11-3-61-MJJT-----32XMO453RFSQK99898996867-55C55E5C9AU-577554555767998Q9ACB6666D8H111111119----895-----------------------------1JJUK17RHBMCDFIPDA6AABAANFEEEE8FSCWUmic24GGBA6CDDMEGINZ128----46-------1-2E662aDG-----------755-A-5--7887B966------------1--------------32-6C265D714433346755548575454---22--------2-4-1--2223233222-2222222212222222221------114331444443424224-1121111-----------------5222226666-JD22---------------GGGEGBE5886-LLLN9JCCGA8AAD537-------------2-----24-224444444444-------2BBA9AA----------1-------------------------1--11-1------ ----569-831-AA9DBB9D998B89CCC6969878AA9A8AAABA977789BD897766664--------------------------7A7B8876555888CCC-B64HDUBBED89779D9IB6J9V*E-EBR5A75D67GB39968C73EACBBM9FF6HBD877BADGCG2223Y43354666C93544D999A ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 385 STR:RPRED 100.0 SQ:SECSTR cccTTcHHHHccHHHHHHHHHHHHHHHHHTHHHHHHHHHHTcccTTHHHHHHTTTcccTTccGGGTcccccHHHHHHHHHHHHHHcHHHHHHHHHHHHTTHHHHHHHccHHHHHHHHHHHHHTcccEEEEccccTcTTcTGTTcccEEEEETTEEEEEEEEEEEETGGGccEEEEEEEEccccEEEEEEETTcTTEEccEEccccccTTccEEEEEEEEEEEEGGGccTTccTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcEETTEEGGGcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTcccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccGGGHHHHHHHHHHHHHHccHHHHHHHHHHccHHHccccc DISOP:02AL 385-386| PSIPRED ccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHcccccccccHHHccccccHHHHHHHHHHHHccccHHHHHHHHcHHHHHHHHHHHccHHHHHHHHHHHccccEEEEEEcccccccccHHHccEEEEEEEccEEEEEEEEEEEEccccccEEEEEEEcccccEEEEEEEcccccEEEEcccccccccccccEEEEEccEEccHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcEEHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHEEccccHHHHHHHHHHHHHccccc //