[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS80801.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:228 amino acids
:PSIPRED
:DISOPRED
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS80801.1 GT:GENE AAS80801.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(440553..441239) GB:FROM 440553 GB:TO 441239 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAS80801.1 GB:DB_XREF GI:46196384 LENGTH 228 SQ:AASEQ MGLRPGVVLVYLDQNHASRMAKHLLGQRGHEAFGRLFLALKGRAIAPPSPFHVLETLFPQRGPEEKAGYLLPALKEVFAALSGGYWVRPWQEVAARQRRGLHREDLLSEEGSWETPADLSPFQGLPEALRGLPYGEAHALALREIRERTGLEEVPFVRLLARLLARMASDLQRKPRPSDLLDAVMAATVYPYVDLLLTDRYLRGLLPEKSVGGRRKEVEALVRRLEGE GT:EXON 1|1-228:0| SEG 158->168|rllarllarma| SEG 194->206|dllltdrylrgll| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 170-174, 226-228| PSIPRED ccccccEEEEEEcccHHHHHHHHHHHcccHHHHHHHHHHHcccccccccHHHHHHHHHccccccHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHccccHHHHHcccccccccccccccccHHHHHHcccccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHccc //