[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS80805.1
DDBJ      :             fumarylacetoacetate hydrolase family protein
Swiss-Prot:             

Homologs  Archaea  56/68 : Bacteria  586/915 : Eukaryota  181/199 : Viruses  0/175   --->[See Alignment]
d.177.1
:264 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->264 2dfuA PDBj e-148 100.0 %
:RPS:PDB   1->264 2dfuB PDBj 3e-80 89.6 %
:RPS:SCOP  47->252 1gttA1  d.177.1.1 * 2e-63 29.4 %
:HMM:SCOP  46->266 1i7oA1 d.177.1.1 * 1.4e-69 50.7 %
:RPS:PFM   52->252 PF01557 * FAA_hydrolase 2e-37 49.0 %
:HMM:PFM   49->252 PF01557 * FAA_hydrolase 2.2e-64 50.5 192/217  
:HMM:PFM   1->44 PF10370 * DUF2437 1.3e-13 56.8 44/50  
:BLT:SWISS 47->252 Y643_PYRHO 2e-48 50.8 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS80805.1 GT:GENE AAS80805.1 GT:PRODUCT fumarylacetoacetate hydrolase family protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION 443338..444132 GB:FROM 443338 GB:TO 444132 GB:DIRECTION + GB:PRODUCT fumarylacetoacetate hydrolase family protein GB:PROTEIN_ID AAS80805.1 GB:DB_XREF GI:46196388 LENGTH 264 SQ:AASEQ MKILRFNEGRWGVLEGELVLETDGPGGNPTGRRYDLASVTLLPPATPTKIVCVGRNYREHIREMGHDFGEDLPKEPGLFLKGPNALARPGNPRDPWGTAEPVPYPFFTEELHYEGELAVVVGDRMRHVPPEKALDHVLGYTVAVDITARDVQKKDLQWVRAKSADKFLPLGPWLETDLNPQDTWVRTYVNGTLRQEGHTSQMIFSVAEILSYISTFMTLEPLDVVLTGTPEGVGALRPGDRLEVAVEGVGTLFTLIGPKEERPW GT:EXON 1|1-264:0| BL:SWS:NREP 1 BL:SWS:REP 47->252|Y643_PYRHO|2e-48|50.8|193/230| BL:PDB:NREP 1 BL:PDB:REP 1->264|2dfuA|e-148|100.0|251/251| RP:PDB:NREP 1 RP:PDB:REP 1->264|2dfuB|3e-80|89.6|249/249| RP:PFM:NREP 1 RP:PFM:REP 52->252|PF01557|2e-37|49.0|192/213|FAA_hydrolase| HM:PFM:NREP 2 HM:PFM:REP 49->252|PF01557|2.2e-64|50.5|192/217|FAA_hydrolase| HM:PFM:REP 1->44|PF10370|1.3e-13|56.8|44/50|DUF2437| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF01557|IPR002529| GO:PFM GO:0008152|"GO:metabolic process"|PF01557|IPR002529| RP:SCP:NREP 1 RP:SCP:REP 47->252|1gttA1|2e-63|29.4|194/213|d.177.1.1| HM:SCP:REP 46->266|1i7oA1|1.4e-69|50.7|209/213|d.177.1.1|1/1|FAH| OP:NHOMO 1899 OP:NHOMOORG 823 OP:PATTERN 11---12333333332-112111221122143-1111111111-----111111111-1111211-11 2221431222221253222-22113522222123433199221524211222795233--113122435211111111----5-11--11111111---11221231213---------------11-11111-111-12211123-111111----------1111111--------1----2222211-31122222222422322233111122214413111111113411111111111111111111-----------11--11-----------------------------------------------------12--1-----------211---------2---1331---1-1112111--1-17111-1--132A781135344333333332332-33633534723-533723433322855313643233245--------221-3412-----------------------------2-3J1-7763678A6762555277755555-564G3A6625443334226672B5331----111111111---221121--1-1-21111111111111-111113-11--1111111--1---------11111--11111-2111111111-111111--111----11-------32221211221111122-2212111211212221223333223314242434444434324522122221-122244424444---1---------11125--------------111111111121244444326123211122111111111-111111111-11131122222222-------1----11--------------------------------------1--------11 ----222-21--1113443755398872222222223333333222434976ED4454333321311111111131111112222211-32142223222212211-111424212211--12-221217F4-3231211312311-1--2-1222214422134433233112211117111-123322221222222 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 264 STR:RPRED 100.0 SQ:SECSTR cEEEEETTTEEEEEETTEEEEEccTTccEEEEEEEGGGccEEcccccccEEEEcccccccccEEEEEcccEEcGGGEEccccTTcHHHHccTTcHHcccccEEEcTTcccEEccEEEEEEEccccccccHHHHGGGEEEEEEEEccEEHHHHHHcccTHHHHccTTcEEEEEEEEccccTTccEEEEEETTEEEEEEEGGGccccHHHHHHHHHTTccccTTcEEEcccccccccccTTcEEEEEETTTEEEEEEEEEEccccc DISOP:02AL 259-264| PSIPRED cEEEEEcccccEEEcccEEEEEccccccccccEEcHHHcEEEcccccccEEEEEccHHHHHHHHHHHcccccccccEEEEccccEEEEcccccccccccccEEEccccccccccEEEEEEEccccccccHHHHHHHHHEEEEEEEccHHHHHccccccEEEEcccccEEEcccccccccccccEEEEEEccEEEEcccHHHHcccHHHHHHHHHcccccccccEEEEcccccccccccccEEEEEEcccEEEEEEEcccccccc //