[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS80806.1
DDBJ      :             metallo-beta-lactamase protein
Swiss-Prot:             

Homologs  Archaea  29/68 : Bacteria  125/915 : Eukaryota  5/199 : Viruses  0/175   --->[See Alignment]
d.157.1
:299 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   18->203 2zwrB PDBj 6e-13 39.6 %
:RPS:PDB   17->207 3dh8A PDBj 9e-15 18.5 %
:RPS:SCOP  16->225 1jt1A  d.157.1.1 * 3e-28 21.7 %
:HMM:SCOP  1->248 1smlA_ d.157.1.1 * 8.8e-45 32.6 %
:RPS:PFM   18->93 PF00753 * Lactamase_B 5e-06 33.8 %
:HMM:PFM   16->209 PF00753 * Lactamase_B 5.3e-23 22.8 184/194  
:BLT:SWISS 20->69 MBLC1_MOUSE 4e-07 48.0 %
:BLT:SWISS 58->165 Y2612_MYCBO 6e-10 39.2 %
:PROS 273->279|PS00092|N6_MTASE
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS80806.1 GT:GENE AAS80806.1 GT:PRODUCT metallo-beta-lactamase protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION 444126..445025 GB:FROM 444126 GB:TO 445025 GB:DIRECTION + GB:PRODUCT metallo-beta-lactamase protein GB:PROTEIN_ID AAS80806.1 GB:DB_XREF GI:46196389 LENGTH 299 SQ:AASEQ MVKVLDLRFQGAERVIASFLLDSGEGPVLVETGPESCYPRLVEALRAEGVAPEEVRHVFVTHIHLDHAGAAWRLAELGATVYVHPRGAPHLVDPSRLLASAERIYGDQLKALWGEVRGIPEERVRLLADGEVVALGGLEVQAVETPGHASHHHAYRVGDLVFTGDVAGVRIAPGPVLPPTPPPDIHLESWYASLDRLLSLRPKALYLTHFGAYEDVEAHLQGLKGVLEAWAGWVLHRLKEGLSEEEMVRRFEAYWHEGLRGAGVDEAGMRLYALADPPFMNLQGLVRYWRKHHPEALEG GT:EXON 1|1-299:0| BL:SWS:NREP 2 BL:SWS:REP 20->69|MBLC1_MOUSE|4e-07|48.0|50/260| BL:SWS:REP 58->165|Y2612_MYCBO|6e-10|39.2|102/224| PROS 273->279|PS00092|N6_MTASE|PDOC00087| SEG 173->183|pgpvlpptppp| BL:PDB:NREP 1 BL:PDB:REP 18->203|2zwrB|6e-13|39.6|154/207| RP:PDB:NREP 1 RP:PDB:REP 17->207|3dh8A|9e-15|18.5|189/299| RP:PFM:NREP 1 RP:PFM:REP 18->93|PF00753|5e-06|33.8|74/171|Lactamase_B| HM:PFM:NREP 1 HM:PFM:REP 16->209|PF00753|5.3e-23|22.8|184/194|Lactamase_B| GO:PFM:NREP 1 GO:PFM GO:0016787|"GO:hydrolase activity"|PF00753|IPR001279| RP:SCP:NREP 1 RP:SCP:REP 16->225|1jt1A|3e-28|21.7|198/262|d.157.1.1| HM:SCP:REP 1->248|1smlA_|8.8e-45|32.6|233/266|d.157.1.1|1/1|Metallo-hydrolase/oxidoreductase| OP:NHOMO 182 OP:NHOMOORG 159 OP:PATTERN 11-1-12-11111111--21121211111113-----------1---------1-------------- ---12--1-----------------1---------------1-1------1----------------1--1-----------1-------------------------1---------------------------22211---11-------------------------------------11133---21-11111--1-111111-1----11111111--------1--------------------------------------------------------------------------------------------------------------1-----1-----1-----2---1---1----2-1111--------11-11-1------11-1-111----------1----11-11----------------------------------------------------------------------2---------------------------------------11---1-------2-------------111111-2-1------------1--1-1-11111--1-------------------------------------------------------------1-11----------------------------------------------1--------------------------------------------------------1------------------111111-----------------------------------------------2211111111------1-111111-----------------------------------------------1- -------------------11-----1-----------------------------------------------------------------------------------------------------------------------------------------------------------------1-----2---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 297 STR:RPRED 99.3 SQ:SECSTR #EEEEcccccccccccEEEEEEETTEEEEEccccGGGHHHHHHHHHHHcccGGGEEEEEcccccTTTTTTHHHHGGGccEEEEEHHHHHHHTcHHHHHHHHHHHHTcccccccccccGGGccEEEEcTTcEEEEETTEEEEEEEcccccTTcEEEEEGGEEEEETTTcEEETTTTEEEccccccccHHHHHHHHHHHHTcccccEEEcccccTHHHHHHHHHHHHHHTTTcTEEEccTTcHHHHHHHHHHHHHTTcEccEEEEEHHHHHHHHHHcEEEETTTTTccccEETccccccT# DISOP:02AL 295-299| PSIPRED cEEEEEEccccccEEEEEEEEEcccEEEEEEccccHHHHHHHHHHHHHcccccccEEEEEEcccHHHHHHHHHHHHcccEEEEccHHHHHHHccHHHccHHHHHHHHHHHHHcccccccccccEEEEccccEEEcccEEEEEEEccccccccEEEEEccEEEEccHHHccccccccccccccccccHHHHHHHHHHHHHccccEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHccHHHcccccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHcc //