[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS80814.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:117 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   46->55 PF04036 * DUF372 0.0006 80.0 10/38  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS80814.1 GT:GENE AAS80814.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(453758..454111) GB:FROM 453758 GB:TO 454111 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAS80814.1 GB:DB_XREF GI:46196397 LENGTH 117 SQ:AASEQ MPLLYLRFYLGSLSLLFAFYLLGHYLLGFPFPTPTTLLHLALGAGAGVGLGALYHRVWPLPPPGLGRVVRLFVLLPPAFMLGIGLLVLLQAQVALPYLVPLLAWLTPDYGKAPSSTP GT:EXON 1|1-117:0| TM:NTM 3 TM:REGION 4->26| TM:REGION 42->64| TM:REGION 76->98| SEG 26->53|llgfpfptpttllhlalgagagvglgal| SEG 63->77|pglgrvvrlfvllpp| SEG 85->95|llvllqaqval| HM:PFM:NREP 1 HM:PFM:REP 46->55|PF04036|0.0006|80.0|10/38|DUF372| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 112-117| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHccccHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccc //