[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS80849.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:177 amino acids
:PSIPRED
:DISOPRED
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS80849.1 GT:GENE AAS80849.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION 486899..487432 GB:FROM 486899 GB:TO 487432 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAS80849.1 GB:DB_XREF GI:46196432 LENGTH 177 SQ:AASEQ MGVVARLLGLGLLLGLAWAQILPPEGGLYVYSDGTVQALEAVEGGYRLAYRRDGKVFREDRLRFGAEGIYLEGVALPKGFFPFAPPLLLYPKRLVLGASWSGNARFQEQRVALAVRVEGVEGVRVPAGRFNAYRLRVAFTTERGGADVKLLYLVPGLGVVAFQAGEGLVGLVRFSAP GT:EXON 1|1-177:0| TM:NTM 2 TM:REGION 1->23| TM:REGION 81->102| SEG 7->16|llglglllgl| SEG 76->91|lpkgffpfapplllyp| SEG 110->129|rvalavrvegvegvrvpagr| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 31-31,34-34,39-39,53-53,67-67,73-74,76-76,81-81,95-95,101-102,104-104,109-109,177-178| PSIPRED ccHHHHHHHHHHHHHHHHHHHccccccEEEEEcccEEEEHHccccEEEEEEEcccEEEHHcEEEcccEEEEEEEEccccccccccccEEcccEEEEEEcccccccEEEEEEEEEEEEEcccEEEEccccccEEEEEEEEEEcccccEEEEEEEEccccEEEEEccccEEEEEEEccc //