[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS80888.1
DDBJ      :             hypothetical membrane spanning protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  169/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:228 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   31->84 1eglA PDBj 4e-11 11.1 %
:RPS:PFM   7->225 PF04298 * Zn_peptidase_2 6e-38 44.4 %
:HMM:PFM   5->220 PF04298 * Zn_peptidase_2 4.7e-90 55.1 216/222  
:PROS 94->103|PS00142|ZINC_PROTEASE
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS80888.1 GT:GENE AAS80888.1 GT:PRODUCT hypothetical membrane spanning protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION 526489..527175 GB:FROM 526489 GB:TO 527175 GB:DIRECTION + GB:PRODUCT hypothetical membrane spanning protein GB:PROTEIN_ID AAS80888.1 GB:DB_XREF GI:46196471 LENGTH 228 SQ:AASEQ MDTLAFLLMILVFVASLAIQGGLQATFARYSRVANSRGLTGAEVARAILDAHGLTHVRVEPVPGALTDHYDPQAKAVRLSEPNYASPSLAALAVAAHEVGHAVQDARGYAWLRVRASLLPAASLGSNLGPILVLAGLFLGALGLAKLGLYLYLAVALFQLITLPVEFDASKRALEFLRRMGFLRPEEMGPARQVLTWAALTYVAALAGSLATILYYASLLGLFGRREE GT:EXON 1|1-228:0| PROS 94->103|PS00142|ZINC_PROTEASE|PDOC00129| TM:NTM 4 TM:REGION 1->23| TM:REGION 115->137| TM:REGION 146->168| TM:REGION 197->219| SEG 85->102|aspslaalavaahevgha| SEG 132->158|lvlaglflgalglaklglylylavalf| RP:PDB:NREP 1 RP:PDB:REP 31->84|1eglA|4e-11|11.1|54/70| RP:PFM:NREP 1 RP:PFM:REP 7->225|PF04298|6e-38|44.4|216/220|Zn_peptidase_2| HM:PFM:NREP 1 HM:PFM:REP 5->220|PF04298|4.7e-90|55.1|216/222|Zn_peptidase_2| OP:NHOMO 173 OP:NHOMOORG 169 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------111-2-----111111--1--1-1111111-1---------------111111111--1111111111----11-------------------------------1111111--11111111111111111121111111211111111111111111111111111111111111-------1-111---------------------------------------------------------11112111111111111111111111111111------111--1111-----1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------1---------------------------1111111111-11 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 54 STR:RPRED 23.7 SQ:SECSTR ##############################ccccTTccccHHHHHHHHHHHcTTcEEEEEETTccccccccccEEEEEEcTTTT################################################################################################################################################ DISOP:02AL 226-228| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHcccccccEEEEcccccccccHHHcEEEcccccccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccc //