[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS80889.1
DDBJ      :             hypothetical conserved protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  6/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:82 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   5->50 PF04981 * NMD3 0.00068 20.9 43/236  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS80889.1 GT:GENE AAS80889.1 GT:PRODUCT hypothetical conserved protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION 527176..527424 GB:FROM 527176 GB:TO 527424 GB:DIRECTION + GB:PRODUCT hypothetical conserved protein GB:PROTEIN_ID AAS80889.1 GB:DB_XREF GI:46196472 LENGTH 82 SQ:AASEQ MPLLLCPNCQVGMREVERRGVLIDVCPQCGGVWLDKGELEKLLAEAEEVERRYEEELEGFYRKEGKPYKRKKGFMKLFDLFD GT:EXON 1|1-82:0| SEG 38->58|elekllaeaeeverryeeele| HM:PFM:NREP 1 HM:PFM:REP 5->50|PF04981|0.00068|20.9|43/236|NMD3| OP:NHOMO 6 OP:NHOMOORG 6 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 49-72| PSIPRED ccccccccccccEEEEEEEEEEEEEccccccEEEcHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHHHccc //