[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS80913.1
DDBJ      :             quaternary ammonium compound-resistance protein
Swiss-Prot:             

Homologs  Archaea  4/68 : Bacteria  335/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
f.39.1
:105 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->66 1s7bB PDBj 5e-11 41.3 %
:HMM:SCOP  5->106 1s7bA_ f.39.1.1 * 3.1e-17 39.2 %
:RPS:PFM   4->66 PF00893 * Multi_Drug_Res 2e-12 61.9 %
:HMM:PFM   3->94 PF00893 * Multi_Drug_Res 1.8e-33 50.0 92/93  
:BLT:SWISS 1->66 QACF_ENTAE 1e-22 65.2 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS80913.1 GT:GENE AAS80913.1 GT:PRODUCT quaternary ammonium compound-resistance protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION 551542..551859 GB:FROM 551542 GB:TO 551859 GB:DIRECTION + GB:PRODUCT quaternary ammonium compound-resistance protein GB:PROTEIN_ID AAS80913.1 GB:DB_XREF GI:46196496 LENGTH 105 SQ:AASEQ MSGWTYLFLAILSEVLASSALKASQGFSRLLPSLVVVGGYGLAFYFLSLALKTVPLSLAYAVWAGVGTAAIALIGAFFFGEAISPKGWLGIALVAVGVVLIRLAD GT:EXON 1|1-105:0| BL:SWS:NREP 1 BL:SWS:REP 1->66|QACF_ENTAE|1e-22|65.2|66/110| TM:NTM 4 TM:REGION 3->25| TM:REGION 29->51| TM:REGION 59->81| TM:REGION 84->105| SEG 67->83|gtaaialigafffgeai| SEG 89->104|lgialvavgvvlirla| BL:PDB:NREP 1 BL:PDB:REP 4->66|1s7bB|5e-11|41.3|63/107| RP:PFM:NREP 1 RP:PFM:REP 4->66|PF00893|2e-12|61.9|63/93|Multi_Drug_Res| HM:PFM:NREP 1 HM:PFM:REP 3->94|PF00893|1.8e-33|50.0|92/93|Multi_Drug_Res| GO:PFM:NREP 1 GO:PFM GO:0016021|"GO:integral to membrane"|PF00893|IPR000390| HM:SCP:REP 5->106|1s7bA_|3.1e-17|39.2|102/106|f.39.1.1|1/1|Multidrug resistance efflux transporter EmrE| OP:NHOMO 433 OP:NHOMOORG 340 OP:PATTERN ------------------------1--1----------------------11---------------- ---------------11-------------------1-----1--------------1----1-1-----------------1-----------------11------------------------1111-1121-11111----------------1111-1---1111----------------11---11233333232-233223--11223-11112--2------1---------------------1---11-----11------2-----1-------------------------------------------1----1-----------111---------1----1-11-------------2-----------1-2--1-1311--11111111111-----1-11----1---1111111112-1-111121211122222222----1-11-------------------------1-1----1-1211121111111111111111111111111121-----1-1111-------1-2-11---11--------211-------1111-------1--1----1----------------------------1111--1---211------21-----112-21---2----------1111-21111122211-2-12--1-12211--1--121-1-11211111211211111131---11111121111111111111---1-------111-1111---1------1-223261-1111122221111111132-11----------122-111111-1--1112121111-------------------------------------------------------------1- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 63 STR:RPRED 60.0 SQ:SECSTR ###cHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHTccccccccccHHHHH####################################### DISOP:02AL 105-106| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHcc //