[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS80951.1
DDBJ      :             hypothetical conserved protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  12/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.38.1
:141 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->138 2cwzA PDBj 1e-69 100.0 %
:RPS:PDB   9->138 2cwzA PDBj 6e-08 82.7 %
:RPS:SCOP  2->138 2cwzA1  d.38.1.7 * 2e-52 97.1 %
:HMM:SCOP  1->138 2cwzA1 d.38.1.7 * 3.7e-39 37.0 %
:HMM:PFM   67->104 PF03061 * 4HBT 9.2e-05 21.1 38/79  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS80951.1 GT:GENE AAS80951.1 GT:PRODUCT hypothetical conserved protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION 586299..586724 GB:FROM 586299 GB:TO 586724 GB:DIRECTION + GB:PRODUCT hypothetical conserved protein GB:PROTEIN_ID AAS80951.1 GB:DB_XREF GI:46196535 LENGTH 141 SQ:AASEQ MRPIPEGYEAVFETVVTPEMTVRFEELGPVHPVYATYWMVKHMELAGRKIILPFLEEGEEGIGSYVEARHLASALPGMRVRVVARHEKTEGNRVYARVEAYNELGDLIGVGRTEQVILPKAKVEALFRRLKERWEAERSPW GT:EXON 1|1-141:0| BL:PDB:NREP 1 BL:PDB:REP 2->138|2cwzA|1e-69|100.0|133/133| RP:PDB:NREP 1 RP:PDB:REP 9->138|2cwzA|6e-08|82.7|127/133| HM:PFM:NREP 1 HM:PFM:REP 67->104|PF03061|9.2e-05|21.1|38/79|4HBT| RP:SCP:NREP 1 RP:SCP:REP 2->138|2cwzA1|2e-52|97.1|137/138|d.38.1.7| HM:SCP:REP 1->138|2cwzA1|3.7e-39|37.0|138/0|d.38.1.7|1/1|Thioesterase/thiol ester dehydrase-isomerase| OP:NHOMO 12 OP:NHOMOORG 12 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111---1------------------------------11-------1-----------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 140 STR:RPRED 99.3 SQ:SECSTR HHHHHHcccTTcEEEEEEEccGGEEEETTEEEEEcHHHHHccHHHHHHHHHTTTccTTEEEEEEEEEEEEcccccTTEcEEEEEEEEEEETTEEEEEEEEEETTccEEEEEEEEEEEEEHHHHHHHHHHHHHHHHTTccc# DISOP:02AL 135-136, 138-139| PSIPRED cccccccccEEEEEEEcHHHcEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEEEEEEEcccccccEEEEEEEEEEEcccEEEEEEEEEEcccEEEEEEEEEEEEEcHHHHHHHHHHHHHHcccccccc //