[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS80965.1
DDBJ      :             hypothetical cytosolic protein
Swiss-Prot:             

Homologs  Archaea  28/68 : Bacteria  400/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:113 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->106 1yyvB PDBj 4e-09 34.0 %
:RPS:PDB   7->102 2d1hA PDBj 5e-11 13.7 %
:RPS:SCOP  12->107 1z7uA1  a.4.5.69 * 9e-28 29.2 %
:HMM:SCOP  5->106 2fswA1 a.4.5.69 * 1.3e-30 48.0 %
:RPS:PFM   24->107 PF01638 * HxlR 4e-16 45.2 %
:HMM:PFM   20->108 PF01638 * HxlR 1.8e-25 38.2 89/91  
:BLT:SWISS 5->106 YTFH_SHIFL 1e-13 34.3 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS80965.1 GT:GENE AAS80965.1 GT:PRODUCT hypothetical cytosolic protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION 599727..600068 GB:FROM 599727 GB:TO 600068 GB:DIRECTION + GB:PRODUCT hypothetical cytosolic protein GB:PROTEIN_ID AAS80965.1 GB:DB_XREF GI:46196549 LENGTH 113 SQ:AASEQ MWYHGGMAEAFCPVYAALNLLQEKWTLHIIRALLEGPKGFNELSRAVGGVNPATLSQRLDQLVRLGVVEKRVESYMPPRTRYSLTPAGEELEEVVQAIERWARRHLKAPDPAR GT:EXON 1|1-113:0| BL:SWS:NREP 1 BL:SWS:REP 5->106|YTFH_SHIFL|1e-13|34.3|102/126| BL:PDB:NREP 1 BL:PDB:REP 5->106|1yyvB|4e-09|34.0|97/107| RP:PDB:NREP 1 RP:PDB:REP 7->102|2d1hA|5e-11|13.7|95/98| RP:PFM:NREP 1 RP:PFM:REP 24->107|PF01638|4e-16|45.2|84/91|HxlR| HM:PFM:NREP 1 HM:PFM:REP 20->108|PF01638|1.8e-25|38.2|89/91|HxlR| RP:SCP:NREP 1 RP:SCP:REP 12->107|1z7uA1|9e-28|29.2|96/108|a.4.5.69| HM:SCP:REP 5->106|2fswA1|1.3e-30|48.0|102/0|a.4.5.69|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 860 OP:NHOMOORG 431 OP:PATTERN 11-----------111-1--1---32231121-------1---562-3-1123--------111---1 1---A--2111---1--22-22--2621222213334242-54821-11---32---2--211-4-7955------11---11-1-1-------2------3---B35-1----------------------------------223-13-----111-----11-21221------------11111--12-5888887482497678134434715--131212111116A--------------------1-1--------2111--11--1-1-1---------1------------1--1---1111--11---1111---361111111111-111----1---------12-------1---1-112-13331-----12334--12222-----------3-33132325261-5443631455123131--14-----12---------321---1-----------------------------1-1111-221211112111111113-1111113121242----4--1--311-1--2---1-1----------1-1-121----1-1-----11---11--1---22--2-11-1-1----1--------1---22--12--1-1--------1-----------1-------------1134-1-1111111111-111111111111111111122255--11111--1---11111131111111--311111111111---------1111--211-----------1--133333-2--1-122-22213-1----11-------------------------12-2-21---1111--------------------1----1-------------------------------12 --------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------1-----1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 110 STR:RPRED 97.3 SQ:SECSTR ###HHHGGGGGHHHHHHHHTccHHHHHHHHHHHHcccEEHHHHHHHHTTccHHHHHHHHHHHHHTTcEEEEEcccEEEEEcTTHHHHHHHHHHHHHHHHTTcHHHHcccHHHH DISOP:02AL 1-5, 108-113| PSIPRED cccccccccccccHHHHHHHHHcHHHHHHHHHHHcccccHHHHHHHHccccHHHHHHHHHHHHHcccEEEEEccccccEEEEEHHHHHHHHHHHHHHHHHHHHHHHccccccc //