[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS80996.1
DDBJ      :             ABC transporter ATP-binding protein
Swiss-Prot:             

Homologs  Archaea  68/68 : Bacteria  906/915 : Eukaryota  105/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:228 amino acids
:PSIPRED
:DISOPRED
:BLT:PDB   2->224 1l2tB PDBj 4e-49 46.2 %
:RPS:PDB   2->222 3b5jA PDBj 2e-35 21.1 %
:RPS:SCOP  2->222 1b0uA  c.37.1.12 * 3e-29 29.0 %
:HMM:SCOP  5->220 1ii8.1 c.37.1.12 * 4.5e-68 47.4 %
:RPS:PFM   46->170 PF00005 * ABC_tran 4e-05 33.1 %
:HMM:PFM   46->170 PF00005 * ABC_tran 2.3e-24 43.1 116/118  
:HMM:PFM   131->215 PF02463 * SMC_N 1.6e-08 32.1 84/220  
:HMM:PFM   21->53 PF03215 * Rad17 2.6e-05 42.4 33/498  
:BLT:SWISS 2->220 YKNY_BACSU 1e-53 47.0 %
:PROS 143->157|PS00211|ABC_TRANSPORTER_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS80996.1 GT:GENE AAS80996.1 GT:PRODUCT ABC transporter ATP-binding protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION 637844..638530 GB:FROM 637844 GB:TO 638530 GB:DIRECTION + GB:PRODUCT ABC transporter ATP-binding protein GB:PROTEIN_ID AAS80996.1 GB:DB_XREF GI:46196580 LENGTH 228 SQ:AASEQ MLLALKGIRKVYRMGEVAFSALKGVDLEVEEGEMLAIMGPSGSGKSTLLHILGLLDRPTEGEYVLMDRPTSRLAEDERAFLRNRFLGFVFQAFFLLPRLSALENVEVPLAYAGVPPGTRRRRALELLERVGLLEKANNLPNQLSGGQRQRVAIARALALNPPLLLADEPTGALDTRTGEEILALFQELNREGTTVILVTHEPHVAEKTNRIVRVLDGEIVADERRHHG GT:EXON 1|1-228:0| BL:SWS:NREP 1 BL:SWS:REP 2->220|YKNY_BACSU|1e-53|47.0|219/230| PROS 143->157|PS00211|ABC_TRANSPORTER_1|PDOC00185| SEG 119->134|rrrralellervglle| SEG 152->166|aiaralalnppllla| BL:PDB:NREP 1 BL:PDB:REP 2->224|1l2tB|4e-49|46.2|223/232| RP:PDB:NREP 1 RP:PDB:REP 2->222|3b5jA|2e-35|21.1|218/243| RP:PFM:NREP 1 RP:PFM:REP 46->170|PF00005|4e-05|33.1|118/123|ABC_tran| HM:PFM:NREP 3 HM:PFM:REP 46->170|PF00005|2.3e-24|43.1|116/118|ABC_tran| HM:PFM:REP 131->215|PF02463|1.6e-08|32.1|84/220|SMC_N| HM:PFM:REP 21->53|PF03215|2.6e-05|42.4|33/498|Rad17| GO:PFM:NREP 2 GO:PFM GO:0005524|"GO:ATP binding"|PF00005|IPR003439| GO:PFM GO:0016887|"GO:ATPase activity"|PF00005|IPR003439| RP:SCP:NREP 1 RP:SCP:REP 2->222|1b0uA|3e-29|29.0|217/258|c.37.1.12| HM:SCP:REP 5->220|1ii8.1|4.5e-68|47.4|211/370|c.37.1.12|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 22560 OP:NHOMOORG 1079 OP:PATTERN FF74EA84EEEEFBF7UDGEFFDDQAALNFGF868645AAB97IH7JHDDcPR7EGEIIBA8A5I144 HKSC*IDDMMP9D9GEDDD-DL44EsDCDDD9UTSUSmwsHXGdRaPMRIH9WVXCHL33USNLgPZ*dsMLJJJhJJKGNJS5447AGGGC1C884--59D89BG9GDD212222133322228GF9FF6BGCHCTQRZZ556RJOINOHFLKNGHD8B9CCIJGRVVVE4A55645A4552ICIIIJH3FFXcddbeejjVgmgeenkYVVSYkfjGKRbSOLUSSRRRznHLLKLKJJKKLLLKIEJHFGRNHLUUKGFHFSQDDRWJIDHMNLNKOONLJHLNTRPPNOMONQNONJHHHGIIIIIIHHPLIGGHKJKJGjSheYZYebdbKYJHdYYEFFBXOLMHiKJHBtnMOKNMIEMIGLE9CJHAMLJJF66766OK***EFQjTTlUbdaedbeabd*-UT*QQuPe**G5*************i98Bin*qkqvughCBCCCCCCTEH8CJNf22212222221122222222222224242B8AA97c*zdepwyuwsgcZbXrr**igifQiyl*fZne5AcaUVNTOQiWxl**ISTHHBESHCCBBBBBJIEOVLLOjEKISRGNcQPW9NMKJHIMGGJMOMbZGTAA8D8A99A765755655557D757IHTQXAWEI7E9ZDIHHHBFHEDDFEEGEGFG5-39IGC1--111fawnHgVWaaWXZVZVX-bXVXWXZYVZbZWUVVUUXtzsruKKJSSRRRSSSSSSRSRRTmSQOSTRVH2ffggjhgefjjj229B89799EEDEG7YQjJJJJKJBBCAAFCCLHIJIIAH8ADSHfcbedpntabgWdQplo777576777BGRRTRTSSTYXTXWIIFCCCCCDD9888334EDD997955443444C5D65753-2343634756234362222CGH79KJLKJ5MA ----87--75232551-------------------------------------------------11--------11-11-1111----1------221---1----314411-3141222-32A9153Di8-9354-3-61388251-1B21R2322H23A296-1846C3372612-E1-112722B-43-1E258- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 221-228| PSIPRED cEEEEEEEEEEEccccEEEEEEcccEEEEcccEEEEEEccccccHHHHHHHHHccccccccEEEEccEEcccccHHHHHHHHHHHccEEEEEEcccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHccHHHHHHcccccccccHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHHHHcccEEEEEEccHHHHHHccEEEEEEccEEEEccccccc //