[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81000.1
DDBJ      :             hypothetical conserved protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  5/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.125.1
:240 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   46->240 2yzyA PDBj 9e-83 99.4 %
:RPS:PDB   46->239 3buuA PDBj 8e-15 14.9 %
:RPS:SCOP  92->240 1iwlA  b.125.1.1 * 2e-09 15.3 %
:HMM:PFM   147->229 PF03888 * MucB_RseB 5.3e-05 25.6 82/314  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81000.1 GT:GENE AAS81000.1 GT:PRODUCT hypothetical conserved protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION 641106..641828 GB:FROM 641106 GB:TO 641828 GB:DIRECTION + GB:PRODUCT hypothetical conserved protein GB:PROTEIN_ID AAS81000.1 GB:DB_XREF GI:46196584 LENGTH 240 SQ:AASEQ MARGPGPGGGIRRRPLRLGPLRLEVAMRKLAAFLGLVGLLSLGLAQSAQEILDRVEKNLSTPWQATVQGRIQGPGGEEELLARVYALPQARLFRVEFLKPGSLEGNFTVITEKEVWNYLYLTNQLVISPREKAKIQGLGFAPQGLGDLKALSEQVDLRLEGEVRLPEGVAWKLVGRSKENQGFAAMELYILKADPRPLRFVFLDEKGKVLADLKVVEFKRTNLTEAQLKRYPKDAQVVRR GT:EXON 1|1-240:0| SEG 3->23|rgpgpgggirrrplrlgplrl| SEG 30->45|laaflglvgllslgla| BL:PDB:NREP 1 BL:PDB:REP 46->240|2yzyA|9e-83|99.4|163/163| RP:PDB:NREP 1 RP:PDB:REP 46->239|3buuA|8e-15|14.9|188/218| HM:PFM:NREP 1 HM:PFM:REP 147->229|PF03888|5.3e-05|25.6|82/314|MucB_RseB| RP:SCP:NREP 1 RP:SCP:REP 92->240|1iwlA|2e-09|15.3|131/177|b.125.1.1| OP:NHOMO 5 OP:NHOMOORG 5 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 194 STR:RPRED 80.8 SQ:SECSTR #############################################ccHHHHHHHHHHHHcccEEEEEEEEEEETTEEcccEEEEEEEETTTTEEEEEEEcTTTTTcEEEEETTEEEEETTccccEEEcTTcEE#TccETTEEHHHHHcccccTTEEEEEEEEEEETTEEEEEEEEEEccTccccEEEEEEETTTccEEEEEEEcTTccEEEEEEEEEEEEETTEEEEEEEEcccccEEEc DISOP:02AL 1-9| PSIPRED cccccccccccccccEEEccEEEHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccEEEEEEEEEEEcccccHHHHHHHHHHccccHHHHEEEcccccccEEEEEcccEEEEEcccccEEEEEEcccccccccccccHHcccHHccccEEEEEEccccccccccEEEEEEEcccccccEEEEEEEEccccccEEEEEEcccccEEEEEEEEEcccccccHHHHHHcccccEEEcc //