[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81003.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:64 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   25->58 PF01170 * UPF0020 0.00097 23.5 34/171  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81003.1 GT:GENE AAS81003.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION 643180..643374 GB:FROM 643180 GB:TO 643374 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAS81003.1 GB:DB_XREF GI:46196587 LENGTH 64 SQ:AASEQ MAVRAVVVIITPEGGKEETAILLDAFQAIFLALPWGERIDARKRIDLLIDAALAQEEEVRGEAD GT:EXON 1|1-64:0| HM:PFM:NREP 1 HM:PFM:REP 25->58|PF01170|0.00097|23.5|34/171|UPF0020| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 57-64| PSIPRED cccEEEEEEEcccccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHccccccccccc //