[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81008.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:94 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   16->57 PF03514 * GRAS 0.00041 40.5 42/374  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81008.1 GT:GENE AAS81008.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION 647197..647481 GB:FROM 647197 GB:TO 647481 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAS81008.1 GB:DB_XREF GI:46196592 LENGTH 94 SQ:AASEQ MRKAKAKPKWTERYEAARARWEEAEAWRTRLAGLGNKAVAVLEKALEEAEGLNPEHKARVAALALKLALAAAPKAEPLPLTFAVSEEWPWGEEG GT:EXON 1|1-94:0| SEG 10->30|wteryeaararweeaeawrtr| SEG 37->50|kavavlekaleeae| SEG 61->80|aalalklalaaapkaeplpl| HM:PFM:NREP 1 HM:PFM:REP 16->57|PF03514|0.00041|40.5|42/374|GRAS| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-11, 92-94| PSIPRED cccccccccHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHccccccccEEEEEcccccccccc //