[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81009.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:106 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   55->85 PF05872 * DUF853 0.00055 41.9 31/504  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81009.1 GT:GENE AAS81009.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION 648791..649111 GB:FROM 648791 GB:TO 649111 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAS81009.1 GB:DB_XREF GI:46196593 LENGTH 106 SQ:AASEQ MYSSSEERALDQVIRYVAAKVGEVCFLTEHHRFSSGFSYLNQIQARGALESQGWTVEEVVPFSSSKGVGVWYAVRNKGWKREEVLVLLLEVSEGVREGYLSLCQTR GT:EXON 1|1-106:0| SEG 82->95|eevlvlllevsegv| HM:PFM:NREP 1 HM:PFM:REP 55->85|PF05872|0.00055|41.9|31/504|DUF853| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-9| PSIPRED ccccHHHHHHHHHHHHHHHHHccEEEEEccccHHHHHHHHHHHHHccccccccccHHHccccccccccEEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHccc //