[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81012.1
DDBJ      :             hypothetical conserved protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.6.1
:155 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  100->154 1j9iA_ a.6.1.5 * 1.8e-05 31.5 %
:HMM:PFM   98->122 PF07900 * DUF1670 0.00033 44.0 25/220  
:BLT:SWISS 95->148 VXIS_STRAM 7e-05 37.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81012.1 GT:GENE AAS81012.1 GT:PRODUCT hypothetical conserved protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION 651303..651770 GB:FROM 651303 GB:TO 651770 GB:DIRECTION + GB:PRODUCT hypothetical conserved protein GB:PROTEIN_ID AAS81012.1 GB:DB_XREF GI:46196596 LENGTH 155 SQ:AASEQ MPRWGARNGTPGKGRPTPGEQNIQAEHLERLRTEHPEHSGAERPKQKQIARPSRGSSGREGVFAVPDGTSLSSRKICFAHEYPSLSSHGFLWYPTGMQEEVLTVAEVAKLLRVSRKTVEKLIYAKKLHAVKVGRVWRIPRAAVEAFLEGKEYREP GT:EXON 1|1-155:0| BL:SWS:NREP 1 BL:SWS:REP 95->148|VXIS_STRAM|7e-05|37.0|54/62| HM:PFM:NREP 1 HM:PFM:REP 98->122|PF07900|0.00033|44.0|25/220|DUF1670| HM:SCP:REP 100->154|1j9iA_|1.8e-05|31.5|54/68|a.6.1.5|1/1|Putative DNA-binding domain| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-22, 31-61, 151-155| PSIPRED ccccccccccccccccccccccccHHHHHHHHHcccccccccccHHHHHccccccccccccEEEcccccccccccEEEEEcccccccccEEEEccccccccccHHHHHHHHcccHHHHHHHHHcccccEEEEccEEEccHHHHHHHHHHHHcccc //