[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81017.1
DDBJ      :             LSU ribosomal protein L19P
Swiss-Prot:RL19_THET2   RecName: Full=50S ribosomal protein L19;

Homologs  Archaea  0/68 : Bacteria  907/915 : Eukaryota  23/199 : Viruses  0/175   --->[See Alignment]
b.34.5
:146 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->106 1vsaN PDBj 1e-57 100.0 %
:RPS:PDB   1->106 3bboR PDBj 6e-28 35.2 %
:RPS:SCOP  1->106 2j01T1  b.34.5.6 * 6e-35 100.0 %
:HMM:SCOP  4->117 2gyaN1 b.34.5.6 * 2.2e-36 57.0 %
:RPS:PFM   5->105 PF01245 * Ribosomal_L19 5e-29 65.3 %
:HMM:PFM   5->113 PF01245 * Ribosomal_L19 2.8e-46 61.5 109/113  
:BLT:SWISS 1->146 RL19_THET2 1e-60 100.0 %
:PROS 88->103|PS01015|RIBOSOMAL_L19
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81017.1 GT:GENE AAS81017.1 GT:PRODUCT LSU ribosomal protein L19P GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(655732..656172) GB:FROM 655732 GB:TO 656172 GB:DIRECTION - GB:PRODUCT LSU ribosomal protein L19P GB:PROTEIN_ID AAS81017.1 GB:DB_XREF GI:46196601 LENGTH 146 SQ:AASEQ MNRGALIKLVESRYVRTDLPEFRPGDTVRVSYKVKEGNRTRIQDFEGIVIRIRRNGFNTTFTVRKVSYGVGVERIFPLHSPLIQKIDIVQRGRARRAKLYFIRNLSDREIRRKLRADRKRIDKDRAAERAAKEEVQKAQEPEASQE GT:EXON 1|1-146:0| SW:ID RL19_THET2 SW:DE RecName: Full=50S ribosomal protein L19; SW:GN Name=rplS; OrderedLocusNames=TT_C0669; SW:KW 3D-structure; Complete proteome; Ribonucleoprotein; Ribosomal protein. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->146|RL19_THET2|1e-60|100.0|146/146| GO:SWS:NREP 2 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| PROS 88->103|PS01015|RIBOSOMAL_L19|PDOC00778| SEG 107->134|dreirrklradrkridkdraaeraakee| BL:PDB:NREP 1 BL:PDB:REP 1->106|1vsaN|1e-57|100.0|106/137| RP:PDB:NREP 1 RP:PDB:REP 1->106|3bboR|6e-28|35.2|105/113| RP:PFM:NREP 1 RP:PFM:REP 5->105|PF01245|5e-29|65.3|101/112|Ribosomal_L19| HM:PFM:NREP 1 HM:PFM:REP 5->113|PF01245|2.8e-46|61.5|109/113|Ribosomal_L19| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF01245|IPR001857| GO:PFM GO:0005622|"GO:intracellular"|PF01245|IPR001857| GO:PFM GO:0005840|"GO:ribosome"|PF01245|IPR001857| GO:PFM GO:0006412|"GO:translation"|PF01245|IPR001857| RP:SCP:NREP 1 RP:SCP:REP 1->106|2j01T1|6e-35|100.0|106/137|b.34.5.6| HM:SCP:REP 4->117|2gyaN1|2.2e-36|57.0|114/0|b.34.5.6|1/1|Translation proteins SH3-like domain| OP:NHOMO 963 OP:NHOMOORG 930 OP:PATTERN -------------------------------------------------------------------- 1111111111111111111-111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111121111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111-1111111111111111111111111111 -------------------------------------------------------------------------------------------------------1-1---------------------------------------------------------------------1112G122113253-32--11111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 106 STR:RPRED 72.6 SQ:SECSTR ccccccTTHHHHTTccccccccccccccccccccccccccccccccccccccccccccccccccccccccTTTccccccccccccccccccccccccccccccccc######################################## DISOP:02AL 1-2, 114-146| PSIPRED ccHHHHHHHHHHHHHHccccccccccEEEEEEEEEccccEEEEEEEEEEEEEcccccccEEEEEEEEcccEEEEEEEcccccEEEEEEEEEccccHHHHHHHHcccccHHHHHHHccccccHHHHHHHHHHHHHHHHccccccccc //