[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81034.1
DDBJ      :             hypothetical conserved protein
Swiss-Prot:Y686_THET2   RecName: Full=UPF0365 protein TT_C0686;

Homologs  Archaea  0/68 : Bacteria  75/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.2.1
:325 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   71->300 1dikA PDBj 5e-13 15.0 %
:RPS:SCOP  41->140 1yo6A1  c.2.1.2 * 4e-04 19.8 %
:RPS:PFM   22->323 PF12127 * YdfA_immunity e-101 76.6 %
:HMM:PFM   4->319 PF12127 * YdfA_immunity 5.2e-168 76.3 316/321  
:BLT:SWISS 1->325 Y686_THET2 e-157 100.0 %
:TM
:COIL
:REPEAT 2|56->86|88->118
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81034.1 GT:GENE AAS81034.1 GT:PRODUCT hypothetical conserved protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(667370..668347) GB:FROM 667370 GB:TO 668347 GB:DIRECTION - GB:PRODUCT hypothetical conserved protein GB:PROTEIN_ID AAS81034.1 GB:DB_XREF GI:46196618 LENGTH 325 SQ:AASEQ MEGLGIVFLAAVVLLFVFLFFSFIPVGLWISAWAAGVRVPLLTLVAMRLRRVPPAKIIYPLIKATKAGLDVRLDRLEAHYLAGGNVDRVVDALIAADKAGIKLTFDRAAAIDLAGRDVLEAVRVSVNPKVIQTPMVAAVAKDGIQLLATARVTVRANIDRLVGGAGEETIIARVGEGIVTTIGSANSHKEVLENPDRISKTVLEKGLDAGTAFEILSVDIADVDVGKNIGAQLQIDQAEADKKIAQAKAEERRAMAVAAEQENRALVEAMRAKLVEAQAQVPLALAEALRKGHLGVMDYYRLKNIEADTDMRESISRAAKPEGEE GT:EXON 1|1-325:0| SW:ID Y686_THET2 SW:DE RecName: Full=UPF0365 protein TT_C0686; SW:GN OrderedLocusNames=TT_C0686; SW:KW Cell membrane; Complete proteome; Membrane; Transmembrane. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->325|Y686_THET2|e-157|100.0|325/325| GO:SWS:NREP 3 GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| COIL:NAA 30 COIL:NSEG 1 COIL:REGION 236->265| TM:NTM 2 TM:REGION 7->29| TM:REGION 43->65| NREPEAT 1 REPEAT 2|56->86|88->118| SEG 7->21|vflaavvllfvflff| SEG 247->262|akaeerramavaaeqe| RP:PDB:NREP 1 RP:PDB:REP 71->300|1dikA|5e-13|15.0|220/869| RP:PFM:NREP 1 RP:PFM:REP 22->323|PF12127|e-101|76.6|299/320|YdfA_immunity| HM:PFM:NREP 1 HM:PFM:REP 4->319|PF12127|5.2e-168|76.3|316/321|YdfA_immunity| RP:SCP:NREP 1 RP:SCP:REP 41->140|1yo6A1|4e-04|19.8|96/237|c.2.1.2| OP:NHOMO 76 OP:NHOMOORG 75 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------111111--1---------1-----------------1-------------------------------------------------------------1111--11---------------111111------11111111111111111111111111111111-----------------------------------------------------------------------11-1--------------------11111---11-1---1--11-------2-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 252 STR:RPRED 77.5 SQ:SECSTR ######################################################################EEEETTEEEEEEcccccccHHHHHHHHHHHHHcccHHHHHHHccGGGGGTTTcccccHHHHHTccccEEcEEEEccEEEEEEEccHHHHHTTccTTccEEEEEHccEEEEccccTTcHHHHHHHHHTcEEEEccTTcEEETTTTEEEETTEEEcccEEEEETTcEEEccccccccc#HHHHHHccccHHHHHHHHHHHHHcccEEEEEcccHHHHHHHHHTTcccEEEEEHHHHHHHHccccccHHHHHHHHH## DISOP:02AL 1-2, 312-325| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccccccccEEEEEEcccccEEEEEEEEccEEEcccEEEccccccEEEEEEEEEEEcccHHHHcccccccEEccHHHHHHHHHHHccccHHHHHccHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHcccccccc //