[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81056.1
DDBJ      :             LSU ribosomal protein L31P
Swiss-Prot:RL31_THET8   RecName: Full=50S ribosomal protein L31;

Homologs  Archaea  0/68 : Bacteria  484/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
d.325.1
:97 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   27->97 2hgu3 PDBj 1e-40 98.6 %
:RPS:PDB   28->95 3bbo1 PDBj 6e-22 29.4 %
:RPS:SCOP  28->76 2hgj31  d.325.1.2 * 2e-19 100.0 %
:HMM:SCOP  27->95 1vs6Z1 d.325.1.2 * 1.5e-22 47.8 %
:RPS:PFM   27->90 PF01197 * Ribosomal_L31 9e-16 56.2 %
:HMM:PFM   28->91 PF01197 * Ribosomal_L31 8.7e-30 56.2 64/69  
:BLT:SWISS 27->97 RL31_THET8 4e-40 98.6 %
:PROS 60->81|PS01143|RIBOSOMAL_L31

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81056.1 GT:GENE AAS81056.1 GT:PRODUCT LSU ribosomal protein L31P GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(695048..695341) GB:FROM 695048 GB:TO 695341 GB:DIRECTION - GB:PRODUCT LSU ribosomal protein L31P GB:PROTEIN_ID AAS81056.1 GB:DB_XREF GI:46196640 LENGTH 97 SQ:AASEQ MPLGVHPLYTKRWLAHGQDRAKKEANVKEGIHPKLVPARIICGCGNVIETYSTKPEIYVEVCSKCHPFYTGQQRFVDTEGRVERFQRRYGDSYRKGR GT:EXON 1|1-97:0| SW:ID RL31_THET8 SW:DE RecName: Full=50S ribosomal protein L31; SW:GN Name=rpmE; OrderedLocusNames=TTHA1073; SW:KW 3D-structure; Complete proteome; Metal-binding; Ribonucleoprotein;Ribosomal protein; RNA-binding; rRNA-binding; Zinc. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 27->97|RL31_THET8|4e-40|98.6|71/71| GO:SWS:NREP 5 GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| PROS 60->81|PS01143|RIBOSOMAL_L31|PDOC00880| BL:PDB:NREP 1 BL:PDB:REP 27->97|2hgu3|1e-40|98.6|71/71| RP:PDB:NREP 1 RP:PDB:REP 28->95|3bbo1|6e-22|29.4|68/72| RP:PFM:NREP 1 RP:PFM:REP 27->90|PF01197|9e-16|56.2|64/69|Ribosomal_L31| HM:PFM:NREP 1 HM:PFM:REP 28->91|PF01197|8.7e-30|56.2|64/69|Ribosomal_L31| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF01197|IPR002150| GO:PFM GO:0005622|"GO:intracellular"|PF01197|IPR002150| GO:PFM GO:0005840|"GO:ribosome"|PF01197|IPR002150| GO:PFM GO:0006412|"GO:translation"|PF01197|IPR002150| RP:SCP:NREP 1 RP:SCP:REP 28->76|2hgj31|2e-19|100.0|49/50|d.325.1.2| HM:SCP:REP 27->95|1vs6Z1|1.5e-22|47.8|69/0|d.325.1.2|1/1|L28p-like| OP:NHOMO 490 OP:NHOMOORG 486 OP:PATTERN -------------------------------------------------------------------- 11111-------1-11111-111111111111111111111--111111-----------11-1111111112221111111---111-------------------------------------111111111-11111111111111111111111111111111111111111111111111111111111-----------------1111---111----------11------------------------------------------------------------------------------------------111111111111111111111111-1111111111111111111111-1--11-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11---1111111111-1111-1111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111--1--1111111-111111111-1-1-11-1111111111111111111111111111111111111111111111111-11111111111111111111111-1111111111111111111111111111111---111111111111111-111111111111-11111111111111--------------1111111111--------11-111-----------------1----11111111111-- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1----------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 71 STR:RPRED 73.2 SQ:SECSTR ##########################ccTTTcccccHHHHHcccccTTTccccccccccccccccccccccccccccccccccccccccccccccHc DISOP:02AL 89-97| PSIPRED ccEEEEEHHHHHHHHHccccccEEEEEcccccccEEEEEEEEcccEEEEEcccccEEEEEEccccccEEcccEEEEEcccHHHHHHHHHcccccccc //