[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81057.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:59 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   9->56 PF03203 * MerC 0.00084 29.2 48/116  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81057.1 GT:GENE AAS81057.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(695349..695528) GB:FROM 695349 GB:TO 695528 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAS81057.1 GB:DB_XREF GI:46196641 LENGTH 59 SQ:AASEQ MRRLPAWSWPFLLAFFALVGLGLLAVLWAVGVLALLGLGALSLLRGVWPRRRWRRLPPG GT:EXON 1|1-59:0| TM:NTM 1 TM:REGION 16->38| SEG 11->58|fllaffalvglgllavlwavgvlallglgalsllrgvwprrrwrrlpp| HM:PFM:NREP 1 HM:PFM:REP 9->56|PF03203|0.00084|29.2|48/116|MerC| OP:NHOMO OP:NHOMOORG 0 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 56-59| PSIPRED cccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccc //