[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81074.1
DDBJ      :             hypothetical conserved protein
Swiss-Prot:             

Homologs  Archaea  36/68 : Bacteria  72/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
d.256.1
:161 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->161 1vggA PDBj 5e-85 98.1 %
:RPS:PDB   1->160 2ekmA PDBj 2e-14 53.5 %
:RPS:SCOP  11->142 1rlhA  d.256.1.1 * 8e-60 50.4 %
:HMM:SCOP  1->161 1vggA_ d.256.1.1 * 1.3e-69 64.6 %
:RPS:PFM   6->160 PF04008 * Adenosine_kin 4e-55 64.9 %
:HMM:PFM   6->161 PF04008 * Adenosine_kin 7.2e-74 65.2 155/155  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81074.1 GT:GENE AAS81074.1 GT:PRODUCT hypothetical conserved protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(710738..711223) GB:FROM 710738 GB:TO 711223 GB:DIRECTION - GB:PRODUCT hypothetical conserved protein GB:PROTEIN_ID AAS81074.1 GB:DB_XREF GI:46196658 LENGTH 161 SQ:AASEQ MELKLIPIEKPENLNVILGQAHFIKTVEDLHEALVTAVPGIRFGLAFSEASGKRLVRRSGTDPELVELAVKNLLNLACGHAFLIVLGEGFYPINVLHAVKACPEVVRIYAATANPLKVVVAEEGEQRAILGVMDGFTPLGVEDEAEVAWRKDLLRRLGYKL GT:EXON 1|1-161:0| BL:PDB:NREP 1 BL:PDB:REP 2->161|1vggA|5e-85|98.1|159/159| RP:PDB:NREP 1 RP:PDB:REP 1->160|2ekmA|2e-14|53.5|159/160| RP:PFM:NREP 1 RP:PFM:REP 6->160|PF04008|4e-55|64.9|154/155|Adenosine_kin| HM:PFM:NREP 1 HM:PFM:REP 6->161|PF04008|7.2e-74|65.2|155/155|Adenosine_kin| RP:SCP:NREP 1 RP:SCP:REP 11->142|1rlhA|8e-60|50.4|131/151|d.256.1.1| HM:SCP:REP 1->161|1vggA_|1.3e-69|64.6|161/0|d.256.1.1|1/1|Ta1353-like| OP:NHOMO 111 OP:NHOMOORG 111 OP:PATTERN 111-11111111111111111111----------1-------------1-----11111111111--- --1--------------11-1---1-1111111-----11------------------------------------------------------------------------------------------------1--11----1111-11--------------1-------------------1111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---1------------1-1-------------------------1------------------------------------------------------------------------------------------------1111---11111-11--1111--111-------1--------------------------11---11--------1--11--11111---1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--11111-1- -------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------1----1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 161 STR:RPRED 100.0 SQ:SECSTR cEEEEEEEcccTTEEEEEEEcccTTHHHHHHHHHHTTccccEEEEEEEcccTTccEEEEEccHHHHHHHHHHHHHHccTTEEEEEEEcccHHHHHHHHHHTcTTccEEEEEEcccEEEEEEEccccEEEEEEEEcccccccccHHHHHHHHHHHHHTTccc DISOP:02AL 161-162| PSIPRED cEEEEEEEccccccEEEEEcccHHHHHHHHHHHHHHcccccEEEEEEEcccccEEEEEccccHHHHHHHHHHHHHHccccEEEEEEcccccccHHHHHHHccHHHEEEEEEccccEEEEEEEcccccEEEEEEccccccccccHHHHHHHHHHHHHHcccc //