[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81087.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:133 amino acids
:PSIPRED
:DISOPRED
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81087.1 GT:GENE AAS81087.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(725007..725408) GB:FROM 725007 GB:TO 725408 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAS81087.1 GB:DB_XREF GI:46196671 LENGTH 133 SQ:AASEQ MRWALGVLAFALGLGAGLWGLEGGLAPKPLPLGGCRPGPLPERADLYANGVVEIPLCREAEVVLRLEGTPAKGEGPWAVVAEGDRVLWQGEVVGLKEVRVRTTGRGVLVLAFLNDLYAPPEDRNLFLRGLKVR GT:EXON 1|1-133:0| TM:NTM 1 TM:REGION 1->23| SEG 4->41|algvlafalglgaglwglegglapkplplggcrpgplp| SEG 98->110|vrvrttgrgvlvl| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 31-31,39-39,53-53,59-60,62-62,90-90,95-95,109-109,115-116,118-118,133-134| PSIPRED ccHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccHHHHcccEEEEEEccccEEEEEEccccccccccEEEEEcccEEEEEccEEcEEEEEEEEcccEEEEEEHHHHHcccccccEEEEEEEEEc //