[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81096.1
DDBJ      :             hypothetical membrane spanning protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  95/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:224 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   91->182 PF03741 * TerC 4e-10 41.8 %
:HMM:PFM   11->181 PF03741 * TerC 5.9e-53 41.5 171/184  
:BLT:SWISS 11->178 YCEF_BACSU 3e-16 30.4 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81096.1 GT:GENE AAS81096.1 GT:PRODUCT hypothetical membrane spanning protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION 735002..735676 GB:FROM 735002 GB:TO 735676 GB:DIRECTION + GB:PRODUCT hypothetical membrane spanning protein GB:PROTEIN_ID AAS81096.1 GB:DB_XREF GI:46196680 LENGTH 224 SQ:AASEQ MSGEDLLVLFSVAALEALLSGDNALVLAVMVRPLPPHLRARALLYGLLGAYLLRGLALLFAVFLIRLWWAQVLGGLYLVYLIVRHFRNHPEGKPLPEASAKTFWRVVLLINLVDLAFAVDSILAVVAFSKDFLLAFLGVALGILFIRLLAGSVVVLMERFPGLEKVAYALVGWAGVKLFLEGTHTLAHLLHRPGLALALPKAVFWGGAFLILTVGGLLAFRKDA GT:EXON 1|1-224:0| BL:SWS:NREP 1 BL:SWS:REP 11->178|YCEF_BACSU|3e-16|30.4|168/257| TM:NTM 6 TM:REGION 8->30| TM:REGION 41->63| TM:REGION 65->87| TM:REGION 103->125| TM:REGION 131->153| TM:REGION 198->220| SEG 32->59|rplpphlrarallygllgayllrglall| SEG 72->81|vlgglylvyl| RP:PFM:NREP 1 RP:PFM:REP 91->182|PF03741|4e-10|41.8|91/178|TerC| HM:PFM:NREP 1 HM:PFM:REP 11->181|PF03741|5.9e-53|41.5|171/184|TerC| GO:PFM:NREP 1 GO:PFM GO:0016021|"GO:integral to membrane"|PF03741|IPR005496| OP:NHOMO 112 OP:NHOMOORG 95 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------1----------------------------1------1--------------------1111---1------1--------111-----------1----------1111--11111-22----12111112112111121111122113---1-2-2222221--1111111111111111111-1--11-1---1111111-1-----------------------------------------------------1-------------------------------1------------------------------------------------------------------------------------------------------------------11----------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 87-102, 223-224| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHccccc //