[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81101.1
DDBJ      :             methylenetetrahydrofolate dehydrogenase (NADP+)/methenyltetrahydrofolate cyclohydrolase
Swiss-Prot:FOLD_THET2   RecName: Full=Bifunctional protein folD;Includes:  RecName: Full=Methylenetetrahydrofolate dehydrogenase;           EC=1.5.1.5;Includes:  RecName: Full=Methenyltetrahydrofolate cyclohydrolase;           EC=3.5.4.9;

Homologs  Archaea  27/68 : Bacteria  887/915 : Eukaryota  188/199 : Viruses  0/175   --->[See Alignment]
c.2.1c.58.1
:282 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->274 1b0aA PDBj 6e-67 49.1 %
:RPS:PDB   2->274 1b0aA PDBj 1e-44 47.3 %
:RPS:SCOP  3->143 1edzA2  c.58.1.2 * 3e-35 22.5 %
:RPS:SCOP  119->273 1a4iA1  c.2.1.7 * 6e-18 50.7 %
:HMM:SCOP  1->118 1a4iA2 c.58.1.2 * 1.9e-36 51.7 %
:HMM:SCOP  119->278 1a4iA1 c.2.1.7 * 1.8e-48 45.6 %
:RPS:PFM   5->117 PF00763 * THF_DHG_CYH 4e-21 50.4 %
:RPS:PFM   121->273 PF02882 * THF_DHG_CYH_C 9e-51 64.1 %
:HMM:PFM   120->273 PF02882 * THF_DHG_CYH_C 1.9e-71 66.9 154/161  
:HMM:PFM   4->117 PF00763 * THF_DHG_CYH 2.2e-37 49.1 114/117  
:BLT:SWISS 1->282 FOLD_THET2 e-159 100.0 %
:PROS 254->262|PS00767|THF_DHG_CYH_2

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81101.1 GT:GENE AAS81101.1 GT:PRODUCT methylenetetrahydrofolate dehydrogenase (NADP+)/methenyltetrahydrofolate cyclohydrolase GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(738873..739721) GB:FROM 738873 GB:TO 739721 GB:DIRECTION - GB:PRODUCT methylenetetrahydrofolate dehydrogenase (NADP+)/methenyltetrahydrofolate cyclohydrolase GB:PROTEIN_ID AAS81101.1 GB:DB_XREF GI:46196685 LENGTH 282 SQ:AASEQ MAAQVLSGHEAAEAVYEEIRARLRSLSFTPSLRVIRLGEDPASVAYVRLKDKRARALGYRSQVEVYPEDLPEEALLERIAALNADEEVDGILVQLPLPPHIRTQRVLEAIHPLKDVDGFHPLNVGRLWSGGKGLFPCTPLGVVRLLKHYGVDLRGKEVVVVGRSNIVGKPLAGLLLREDATVTLAHSKTQDLPQVTRRAQVLVVAVGRPHLVRKEWVREGAIVVDVGVNRVEGRLLGDVHPEVAEVASALTPVPGGVGPMTVAMLMGNTLEAALLRRHGASG GT:EXON 1|1-282:0| SW:ID FOLD_THET2 SW:DE RecName: Full=Bifunctional protein folD;Includes: RecName: Full=Methylenetetrahydrofolate dehydrogenase; EC=1.5.1.5;Includes: RecName: Full=Methenyltetrahydrofolate cyclohydrolase; EC=3.5.4.9; SW:GN Name=folD; OrderedLocusNames=TT_C0755; SW:KW Amino-acid biosynthesis; Complete proteome; Histidine biosynthesis;Hydrolase; Methionine biosynthesis; Multifunctional enzyme; NADP;One-carbon metabolism; Oxidoreductase; Purine biosynthesis. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->282|FOLD_THET2|e-159|100.0|282/282| GO:SWS:NREP 9 GO:SWS GO:0008652|"GO:cellular amino acid biosynthetic process"|Amino-acid biosynthesis| GO:SWS GO:0000105|"GO:histidine biosynthetic process"|Histidine biosynthesis| GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| GO:SWS GO:0009086|"GO:methionine biosynthetic process"|Methionine biosynthesis| GO:SWS GO:0003824|"GO:catalytic activity"|Multifunctional enzyme| GO:SWS GO:0006730|"GO:one-carbon metabolic process"|One-carbon metabolism| GO:SWS GO:0016491|"GO:oxidoreductase activity"|Oxidoreductase| GO:SWS GO:0055114|"GO:oxidation reduction"|Oxidoreductase| GO:SWS GO:0006164|"GO:purine nucleotide biosynthetic process"|Purine biosynthesis| PROS 254->262|PS00767|THF_DHG_CYH_2|PDOC00616| BL:PDB:NREP 1 BL:PDB:REP 2->274|1b0aA|6e-67|49.1|273/287| RP:PDB:NREP 1 RP:PDB:REP 2->274|1b0aA|1e-44|47.3|273/287| RP:PFM:NREP 2 RP:PFM:REP 5->117|PF00763|4e-21|50.4|113/118|THF_DHG_CYH| RP:PFM:REP 121->273|PF02882|9e-51|64.1|153/160|THF_DHG_CYH_C| HM:PFM:NREP 2 HM:PFM:REP 120->273|PF02882|1.9e-71|66.9|154/161|THF_DHG_CYH_C| HM:PFM:REP 4->117|PF00763|2.2e-37|49.1|114/117|THF_DHG_CYH| GO:PFM:NREP 4 GO:PFM GO:0003824|"GO:catalytic activity"|PF00763|IPR000672| GO:PFM GO:0009396|"GO:folic acid and derivative biosynthetic process"|PF00763|IPR000672| GO:PFM GO:0003824|"GO:catalytic activity"|PF02882|IPR000672| GO:PFM GO:0009396|"GO:folic acid and derivative biosynthetic process"|PF02882|IPR000672| RP:SCP:NREP 2 RP:SCP:REP 3->143|1edzA2|3e-35|22.5|138/146|c.58.1.2| RP:SCP:REP 119->273|1a4iA1|6e-18|50.7|152/160|c.2.1.7| HM:SCP:REP 1->118|1a4iA2|1.9e-36|51.7|118/125|c.58.1.2|1/1|Aminoacid dehydrogenase-like, N-terminal domain| HM:SCP:REP 119->278|1a4iA1|1.8e-48|45.6|160/170|c.2.1.7|1/1|NAD(P)-binding Rossmann-fold domains| OP:NHOMO 1634 OP:NHOMOORG 1102 OP:PATTERN ------------------11111-21111111-----------11-1111111--------111--11 1111211111111111111-11111111111111111222122111111111221111112221222211111111111112311111111111111--1111111111111111111111111111111111111111111121111111111111111111111111111111111111112211111121111111111111111111111111111111111111111211111111111111111111111111111221111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111222111211111111111111111111111111111111111111111111111-1-------1211311122211322111111121111313111111111111-11111111111111111111111111111111112311112211111111111111121111111111111111112111111111111111111111-1111111111111111111111111212122111111122111111111111111111111111111111111112111111111111111111111111-1111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111121111111111111112111111111111332211122211111111121111111111111111111111111111111111111111111111111----1-111-111---111111---1111111111111 ----332-311-12222121222323222222212222222222222222332322212222333333233232333-3333333233-222212211123-1435-16245757743242443764F1Jd5-8563442624554432353354553333223242633D21121333Y2222163641431147433 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 279 STR:RPRED 98.9 SQ:SECSTR cccEEccHHHHHHHHHHHHHHHHHHHHcccEEEEEEEcccHHHHHHHHHHHHHHHHHTcEEccEEEcTTccHHHHHHHHHHHHTcTTccEEEEcccccTTccHHHHHTTccTTTcTTcccHHHHHHHHTTccccccHHHHHHHHHHHHTTcccTTcEEEEEcccTTTHHHHHHHHHTTTcEEEEEccccccHHHHHHHccEEEEccccTTcccTTTccTTcEEEEccEEcTTccEEccccHHHHHHccEEcccccccHHHHHHHHHHHHHHHHHHcHTT### DISOP:02AL 278-282| PSIPRED ccEEEEcHHHHHHHHHHHHHHHHHHcccccEEEEEEEcccHHHHHHHHHHHHHHHHcccEEEEEEccccccHHHHHHHHHHHcccccccEEEEEccccccccHHHHHHHcccccccccccHHHHHHHHccccccccccHHHHHHHHHHHcccccccEEEEEcccccHHHHHHHHHHHcccEEEEEEcccccHHHHHHHccEEEEEEcccccccccccccccEEEEEEEEEccccEEEcccHHHHHHccEEccccccccHHHHHHHHHHHHHHHHHccccccc //