[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81102.1
DDBJ      :             N utilization substance protein B-like protein
Swiss-Prot:NUSB_THET8   RecName: Full=N utilization substance protein B homolog;         Short=Protein nusB;

Homologs  Archaea  0/68 : Bacteria  202/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.79.1
:151 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   46->143 1tzwA PDBj 2e-16 39.8 %
:RPS:PDB   43->139 3d3cA PDBj 1e-20 27.1 %
:RPS:SCOP  43->143 1tztA  a.79.1.1 * 8e-22 39.6 %
:HMM:SCOP  1->135 1eyvA_ a.79.1.1 * 1.6e-31 37.2 %
:RPS:PFM   45->135 PF01029 * NusB 1e-14 39.6 %
:HMM:PFM   3->137 PF01029 * NusB 1.2e-36 41.4 133/134  
:BLT:SWISS 16->151 NUSB_THET8 6e-69 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81102.1 GT:GENE AAS81102.1 GT:PRODUCT N utilization substance protein B-like protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(739722..740177) GB:FROM 739722 GB:TO 740177 GB:DIRECTION - GB:PRODUCT N utilization substance protein B-like protein GB:PROTEIN_ID AAS81102.1 GB:DB_XREF GI:46196686 LENGTH 151 SQ:AASEQ MRRRARELAMRALFAHTVGGMGLEEAFQHALEEMGGEEEGYAEPLDQEGVAFARRLLSGYKAHQEEVDRVLEETVEGWDFRQMAKTDLAVLRLAVYEMLYEPTPFEPLIEVAVKIANRYGGEHSGSFVNGVLARVYRRVAAGELKTVAKEA GT:EXON 1|1-151:0| SW:ID NUSB_THET8 SW:DE RecName: Full=N utilization substance protein B homolog; Short=Protein nusB; SW:GN Name=nusB; OrderedLocusNames=TTHA1121; SW:KW Complete proteome; Transcription; Transcription regulation;Transcription termination. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 16->151|NUSB_THET8|6e-69|100.0|136/151| GO:SWS:NREP 3 GO:SWS GO:0006350|"GO:transcription"|Transcription| GO:SWS GO:0045449|"GO:regulation of transcription"|Transcription regulation| GO:SWS GO:0006353|"GO:transcription termination"|Transcription termination| SEG 1->15|mrrrarelamralfa| SEG 32->40|eemggeeeg| BL:PDB:NREP 1 BL:PDB:REP 46->143|1tzwA|2e-16|39.8|98/142| RP:PDB:NREP 1 RP:PDB:REP 43->139|3d3cA|1e-20|27.1|96/138| RP:PFM:NREP 1 RP:PFM:REP 45->135|PF01029|1e-14|39.6|91/124|NusB| HM:PFM:NREP 1 HM:PFM:REP 3->137|PF01029|1.2e-36|41.4|133/134|NusB| GO:PFM:NREP 2 GO:PFM GO:0003723|"GO:RNA binding"|PF01029|IPR006027| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF01029|IPR006027| RP:SCP:NREP 1 RP:SCP:REP 43->143|1tztA|8e-22|39.6|101/141|a.79.1.1| HM:SCP:REP 1->135|1eyvA_|1.6e-31|37.2|129/131|a.79.1.1|1/1|NusB-like| OP:NHOMO 203 OP:NHOMOORG 202 OP:PATTERN -------------------------------------------------------------------- 1-111-----------------------------------1-------111-------------111--1---------111--------------------------1------------------1--1-11--1111111111111111-1111-------11----1------------11111--1111111111111111111111111111111111111111111111111111111111111111-1----1------------11-------1---------------------------------111----111-1-------1-11-111111111-111111111-1---111111-----1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111-111-11111-1111111111111111--1------------------1111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---1111--------11--------------------------11-1111111--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 117 STR:RPRED 77.5 SQ:SECSTR #################HHcccHHHHHHHHH#########HHcccTTccHHHHHHHHHHHHTcHHHHHHHHGGGTTTcccccccHHHHHHHHHHHHHHHHcTccHHHHHHHHHHHHHHHccTTHHHHHHHHHHHHHHHHcTTc######## DISOP:02AL 141-151| PSIPRED ccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHccccc //