[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81106.1
DDBJ      :             protein translation elongation factor P (EF-P)
Swiss-Prot:EFP_THET8    RecName: Full=Elongation factor P;         Short=EF-P;

Homologs  Archaea  0/68 : Bacteria  906/915 : Eukaryota  28/199 : Viruses  0/175   --->[See Alignment]
b.34.5b.40.4
:184 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->184 1uebA PDBj e-105 100.0 %
:RPS:PDB   1->122 1eifA PDBj 1e-25 26.1 %
:RPS:SCOP  1->63 1uebA1  b.34.5.2 * 2e-18 100.0 %
:RPS:SCOP  64->126 1uebA2  b.40.4.5 * 1e-18 100.0 %
:RPS:SCOP  127->184 1uebA3  b.40.4.5 * 5e-16 100.0 %
:HMM:SCOP  1->63 1uebA1 b.34.5.2 * 2.3e-17 50.8 %
:HMM:SCOP  64->126 1uebA2 b.40.4.5 * 4.8e-18 47.6 %
:HMM:SCOP  127->184 1uebA3 b.40.4.5 * 1.4e-20 72.4 %
:RPS:PFM   6->60 PF08207 * EFP_N 9e-09 50.9 %
:RPS:PFM   68->120 PF01132 * EFP 5e-10 52.8 %
:RPS:PFM   128->183 PF09285 * Elong-fact-P_C 3e-17 78.6 %
:HMM:PFM   128->183 PF09285 * Elong-fact-P_C 1.1e-30 73.2 56/56  
:HMM:PFM   3->60 PF08207 * EFP_N 6.7e-23 46.6 58/58  
:HMM:PFM   67->120 PF01132 * EFP 1.8e-19 48.1 54/55  
:BLT:SWISS 1->184 EFP_THET8 e-105 100.0 %
:PROS 149->168|PS01275|EFP

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81106.1 GT:GENE AAS81106.1 GT:PRODUCT protein translation elongation factor P (EF-P) GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(742436..742990) GB:FROM 742436 GB:TO 742990 GB:DIRECTION - GB:PRODUCT protein translation elongation factor P (EF-P) GB:PROTEIN_ID AAS81106.1 GB:DB_XREF GI:46196690 LENGTH 184 SQ:AASEQ MISVTDLRPGTKVKMDGGLWECVEYQHQKLGRGGAKVVAKFKNLETGATVERTFNSGEKLEDIYVETRELQYLYPEGEEMVFMDLETYEQFAVPRSRVVGAEFFKEGMTALGDMYEGQPIKVTPPTVVELKVVDTPPGVRGDTVSGGSKPATLETGAVVQVPLFVEPGEVIKVDTRTGEYVGRA GT:EXON 1|1-184:0| SW:ID EFP_THET8 SW:DE RecName: Full=Elongation factor P; Short=EF-P; SW:GN Name=efp; OrderedLocusNames=TTHA1125; SW:KW 3D-structure; Complete proteome; Cytoplasm; Elongation factor;Protein biosynthesis. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->184|EFP_THET8|e-105|100.0|184/184| GO:SWS:NREP 3 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0003746|"GO:translation elongation factor activity"|Elongation factor| GO:SWS GO:0006412|"GO:translation"|Protein biosynthesis| PROS 149->168|PS01275|EFP|PDOC00981| BL:PDB:NREP 1 BL:PDB:REP 1->184|1uebA|e-105|100.0|184/184| RP:PDB:NREP 1 RP:PDB:REP 1->122|1eifA|1e-25|26.1|115/128| RP:PFM:NREP 3 RP:PFM:REP 6->60|PF08207|9e-09|50.9|55/58|EFP_N| RP:PFM:REP 68->120|PF01132|5e-10|52.8|53/55|EFP| RP:PFM:REP 128->183|PF09285|3e-17|78.6|56/56|Elong-fact-P_C| HM:PFM:NREP 3 HM:PFM:REP 128->183|PF09285|1.1e-30|73.2|56/56|Elong-fact-P_C| HM:PFM:REP 3->60|PF08207|6.7e-23|46.6|58/58|EFP_N| HM:PFM:REP 67->120|PF01132|1.8e-19|48.1|54/55|EFP| GO:PFM:NREP 2 GO:PFM GO:0003746|"GO:translation elongation factor activity"|PF01132|IPR001059| GO:PFM GO:0006414|"GO:translational elongation"|PF01132|IPR001059| RP:SCP:NREP 3 RP:SCP:REP 1->63|1uebA1|2e-18|100.0|63/63|b.34.5.2| RP:SCP:REP 64->126|1uebA2|1e-18|100.0|63/63|b.40.4.5| RP:SCP:REP 127->184|1uebA3|5e-16|100.0|58/58|b.40.4.5| HM:SCP:REP 1->63|1uebA1|2.3e-17|50.8|63/0|b.34.5.2|1/1|Translation proteins SH3-like domain| HM:SCP:REP 64->126|1uebA2|4.8e-18|47.6|63/63|b.40.4.5|1/1|Nucleic acid-binding proteins| HM:SCP:REP 127->184|1uebA3|1.4e-20|72.4|58/58|b.40.4.5|1/1|Nucleic acid-binding proteins| OP:NHOMO 1136 OP:NHOMOORG 934 OP:PATTERN -------------------------------------------------------------------- 1221111111111111111-111111111111111111111111111111111111111111111111111-1111111111111111111111221--1111111211122222222222222211111111111111112221111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111121222212221111232221111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112111111111221111111111111111111111-11111111121111111111111111111112222211111111111111111111111111111111111111111111111111111111111111211111111111111111111112111111111111111111111111111111111111111112111111111111222222222111111111111111111111111111111111111112222122212111111111111111211-1111111111122222222222222222-222222222222222122222222222222222222121222222222222112222222122221112111111111122121111111111111111111111111111111111111111111111111111122222222222222222222222222222111111111-1111111111111111-11111111111111111111111111111111 ------------111----------------------------------------------------------------------------------------1----3------------------------------------------------------1-----------1212F-11122222-221111111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 184 STR:RPRED 100.0 SQ:SECSTR EEEGGGccTTcEEEETTEEEEEEEEEEEccccccEEEEEEEEEcccccEEEEEEETTcEEEEEccEEEEEEEEEEETTEEEEEETTTccEEEEEccTTcHHHHHHccccTTcEEETTEEEEEEEEcEEEEEEEEcccccccccccccEEEEEETTccEEEEETTccTTcEEEEETTTTEEEEEc DISOP:02AL 183-184| PSIPRED ccEEEEEccccEEEEccEEEEEEEEEEEccccccEEEEEEEEEcccccEEEEEEccccEEEEEEEEEEEEEEEEEcccEEEEEccccccEEEEcHHHcccHHHcccccEEEEEEEccEEEEEEcccEEEEEEEEcccccccEEcccccccEEEEccEEEEcccccccccEEEEEcccccEEEcc //