[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81107.1
DDBJ      :             hypothetical conserved protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  34/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:300 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   69->111 PF01876 * RNase_P_p30 0.00043 27.9 43/150  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81107.1 GT:GENE AAS81107.1 GT:PRODUCT hypothetical conserved protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(742987..743889) GB:FROM 742987 GB:TO 743889 GB:DIRECTION - GB:PRODUCT hypothetical conserved protein GB:PROTEIN_ID AAS81107.1 GB:DB_XREF GI:46196691 LENGTH 300 SQ:AASEQ MAKRVVSVSLGSSRRDAAAEVELLGERVLLERRGTDGDFQRALCLIQELDGKVDAIGLGGIDLYLFAGGRRYAIRDALRLKEAAKKTPVVDGSGLKHTLERRAVRELASLIDWRKTKVLLPSAVDRFGLAEALDEAGARVLYGDFIFALGLPIPLYSLSFLQKLAFLLLPLFTRLPFSVLYPTGKKQEEVREDWRARYYAWADVVAGDWHYVRRHMPKDMRGKTVITNTTTEEDVAFLRERGVRRLVTTTPRLGGRSFGTNVMEAMLVALAGRELGEADYLRYIDQIGLKPQVLELEGQA GT:EXON 1|1-300:0| SEG 4->15|rvvsvslgssrr| SEG 17->34|aaaevellgervllerrg| SEG 158->177|lsflqklaflllplftrlpf| HM:PFM:NREP 1 HM:PFM:REP 69->111|PF01876|0.00043|27.9|43/150|RNase_P_p30| OP:NHOMO 38 OP:NHOMOORG 34 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------11122---1--------------------------------------11111---------------------------------------------------------------------------------------------------------------------------------------111-------------------------1--11--1121112111111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------1-1-----------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 297-300| PSIPRED cccEEEEEEccccccccEEEEEEEccEEEEEEEcccccHHHHHHHHHHHcccEEEEEEccccEEEEEccEEcHHHHHHHHHHccccccEEccHHHHHHHHHHHHHHHHcccccccccEEEEccHHHHHHHHHHHHHcccEEEEHHHHHcccccccccHHHHHHHHHHHHHHHHHccHHEEccccccHHHcccHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEEccccHHHHHHHHHHcccEEEEcccccccccHHHHHHHHHHHHHccccccHHHHHHHHHHcccccEEEEccccc //