[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81114.1
DDBJ      :             cytochrome c oxidase polypeptide IIA
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
f.23.9
:34 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->34 1ehkC PDBj 3e-06 100.0 %
:RPS:PDB   2->34 1ehkC PDBj 8e-05 57.6 %
:HMM:SCOP  2->34 1ehkC_ f.23.9.1 * 9.8e-14 100.0 %
:HMM:PFM   1->34 PF08113 * CoxIIa 3.7e-30 100.0 34/34  
:BLT:SWISS 1->34 COXA_THET8 8e-07 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81114.1 GT:GENE AAS81114.1 GT:PRODUCT cytochrome c oxidase polypeptide IIA GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION 748501..748605 GB:FROM 748501 GB:TO 748605 GB:DIRECTION + GB:PRODUCT cytochrome c oxidase polypeptide IIA GB:PROTEIN_ID AAS81114.1 GB:DB_XREF GI:46196698 LENGTH 34 SQ:AASEQ MEEKPKGALAVILVLTLTILVFWLGVYAVFFARG GT:EXON 1|1-34:0| BL:SWS:NREP 1 BL:SWS:REP 1->34|COXA_THET8|8e-07|100.0|34/100| TM:NTM 1 TM:REGION 8->30| SEG 8->21|alavilvltltilv| BL:PDB:NREP 1 BL:PDB:REP 2->34|1ehkC|3e-06|100.0|33/33| RP:PDB:NREP 1 RP:PDB:REP 2->34|1ehkC|8e-05|57.6|33/33| HM:PFM:NREP 1 HM:PFM:REP 1->34|PF08113|3.7e-30|100.0|34/34|CoxIIa| HM:SCP:REP 2->34|1ehkC_|9.8e-14|100.0|33/33|f.23.9.1|1/1|Bacterial ba3 type cytochrome c oxidase subunit IIa| OP:NHOMO OP:NHOMOORG 0 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 33 STR:RPRED 97.1 SQ:SECSTR #cccTHHHHHHHHHHHHHHHHHHHHHHHHHHHTc DISOP:02AL 1-6| PSIPRED cccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //