[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81115.1
DDBJ      :             subunit II of C(O/B)3-type cytochrome c oxidase
Swiss-Prot:COX2_THET8   RecName: Full=Cytochrome c oxidase subunit 2;         EC=1.9.3.1;AltName: Full=Cytochrome c oxidase polypeptide II;AltName: Full=Cytochrome c ba(3) subunit II;AltName: Full=Cytochrome cba3 subunit 2;

Homologs  Archaea  15/68 : Bacteria  122/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.6.1f.17.2
:168 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->168 1ehkB PDBj 2e-97 100.0 %
:RPS:PDB   47->168 2cuaA PDBj 9e-22 100.0 %
:RPS:SCOP  41->168 1ehkB1  b.6.1.2 * 4e-35 100.0 %
:HMM:SCOP  3->40 1ehkB2 f.17.2.1 * 1.5e-19 100.0 %
:HMM:SCOP  34->168 2cuaB_ b.6.1.2 * 2.5e-37 29.6 %
:RPS:PFM   4->40 PF09125 * COX2-transmemb 5e-17 94.6 %
:RPS:PFM   93->160 PF00116 * COX2 2e-10 33.8 %
:HMM:PFM   3->40 PF09125 * COX2-transmemb 3.3e-31 100.0 38/38  
:HMM:PFM   92->166 PF00116 * COX2 2.2e-24 33.3 75/120  
:BLT:SWISS 1->168 COX2_THET8 6e-98 100.0 %
:PROS 112->160|PS00078|COX2
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81115.1 GT:GENE AAS81115.1 GT:PRODUCT subunit II of C(O/B)3-type cytochrome c oxidase GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION 748608..749114 GB:FROM 748608 GB:TO 749114 GB:DIRECTION + GB:PRODUCT subunit II of C(O/B)3-type cytochrome c oxidase GB:PROTEIN_ID AAS81115.1 GB:DB_XREF GI:46196699 LENGTH 168 SQ:AASEQ MVDEHKAHKAILAYEKGWLAFSLAMLFVFIALIAYTLATHTAGVIPAGKLERVDPTTVRQEGPWADPAQAVVQTGPNQYTVYVLAFAFGYQPNPIEVPQGAEIVFKITSPDVIHGFHVEGTNINVEVLPGEVSTVRYTFKRPGEYRIICNQYCGLGHQNMFGTIVVKE GT:EXON 1|1-168:0| SW:ID COX2_THET8 SW:DE RecName: Full=Cytochrome c oxidase subunit 2; EC=1.9.3.1;AltName: Full=Cytochrome c oxidase polypeptide II;AltName: Full=Cytochrome c ba(3) subunit II;AltName: Full=Cytochrome cba3 subunit 2; SW:GN Name=cbaB; Synonyms=ctaC; OrderedLocusNames=TTHA1134; SW:KW 3D-structure; Cell membrane; Complete proteome; Copper;Direct protein sequencing; Electron transport; Membrane;Metal-binding; Oxidoreductase; Respiratory chain; Transmembrane;Transport. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->168|COX2_THET8|6e-98|100.0|168/168| GO:SWS:NREP 9 GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0022900|"GO:electron transport chain"|Electron transport| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0016491|"GO:oxidoreductase activity"|Oxidoreductase| GO:SWS GO:0055114|"GO:oxidation reduction"|Oxidoreductase| GO:SWS GO:0070469|"GO:respiratory chain"|Respiratory chain| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| GO:SWS GO:0006810|"GO:transport"|Transport| PROS 112->160|PS00078|COX2|PDOC00075| TM:NTM 1 TM:REGION 20->42| BL:PDB:NREP 1 BL:PDB:REP 3->168|1ehkB|2e-97|100.0|166/166| RP:PDB:NREP 1 RP:PDB:REP 47->168|2cuaA|9e-22|100.0|122/122| RP:PFM:NREP 2 RP:PFM:REP 4->40|PF09125|5e-17|94.6|37/38|COX2-transmemb| RP:PFM:REP 93->160|PF00116|2e-10|33.8|68/119|COX2| HM:PFM:NREP 2 HM:PFM:REP 3->40|PF09125|3.3e-31|100.0|38/38|COX2-transmemb| HM:PFM:REP 92->166|PF00116|2.2e-24|33.3|75/120|COX2| GO:PFM:NREP 3 GO:PFM GO:0004129|"GO:cytochrome-c oxidase activity"|PF00116|IPR002429| GO:PFM GO:0005507|"GO:copper ion binding"|PF00116|IPR002429| GO:PFM GO:0016020|"GO:membrane"|PF00116|IPR002429| RP:SCP:NREP 1 RP:SCP:REP 41->168|1ehkB1|4e-35|100.0|128/128|b.6.1.2| HM:SCP:REP 3->40|1ehkB2|1.5e-19|100.0|38/38|f.17.2.1|1/1|Cytochrome c oxidase subunit II-like, transmembrane region| HM:SCP:REP 34->168|2cuaB_|2.5e-37|29.6|135/135|b.6.1.2|1/1|Cupredoxins| OP:NHOMO 172 OP:NHOMOORG 137 OP:PATTERN 11----1-----------2-1---31121112----------------------------------11 -2---------------------------------------------------------------------------------2------------------------2---------------------------22211----3-----------111111----112-1111-1-1-111-1-11----1-----------------1-------1231111------1-1--------------------------------------------------------------------------------------------------------------------------11-----------------------------11121----1-------------13221311----1---1--11-----------------1---------11--1-----------------------------------------11----1-----11121111112111212--1121--------1-1-1-------1-----1111--------11---111-1---1-1--213221---------------------------------1----------------------------2---------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------111111----------------------------------------------11- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 166 STR:RPRED 98.8 SQ:SECSTR ##cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccTTccccccccTTTTTTccTTTcGGGcEEEEETTEEEEEEEEETTEEEcccEEEETTcEEEEEEEcccccEEEEETTcccEEEEccTccEEEEEEccccEEEEEEccccccTTcTTcEEEEEEEc DISOP:02AL 1-4| PSIPRED cccccccccccEEEEEEHHHHHHHHHHHHHHHHHHEEEEEccccccccEEccccccEEEccccccccccccccccccEEEEEEEEEEEcccccEEEEEcccEEEEEEEEcccEEEEEHHHcccEEEEEccEEEEEEEEEcccEEEEEEEEcccccccccccEEEEEEc //